PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g25150.1.p
Common NameBRADI_2g25150, LOC100835933
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 369aa    MW: 39966.6 Da    PI: 6.3767
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g25150.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.33.1e-49461712128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                       +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++  +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +  
  Bradi2g25150.1.p  46 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRG 137
                       79***************************.89***************7777899*************************************** PP

               NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++ +glkktLvfy+g+apkg++++W+m+eyrl
  Bradi2g25150.1.p 138 ENSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 171
                       ********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100554.88545194IPR003441NAC domain
SuperFamilySSF1019411.19E-5745194IPR003441NAC domain
PfamPF023651.4E-2447171IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MSRDIDEGSV PGAVAGGGGE LEGSEPVAGG GEVEAAADSH ENDLVMPGFR FHPTEEELIE  60
FYLRRKVEGR RFNVELITFL DLYRFDPWEL PAMAVIGEKE WFFYVPRDRK YRNGDRPNRV  120
TASGYWKATG ADRMIRGENS RPIGLKKTLV FYSGKAPKGV RSSWIMNEYR LPPPTTDADL  180
FYKSEISLCR VYKRSGIDDG GHGRASSSSN VQSTSSMPGP SRTSAPTGRQ HGPSPTQQPT  240
SFHLIGQAQC STTVPPPAIV DVQATAHNAL HPPPLPPGPS CAYDEHAPLI GNSSTPVDDE  300
LSRLVGHGQA YAIANHQDAG THFFPMPPPP APHPLGVLPM SPAAGSDKLW DWNPDTTSSK  360
DYGGSSYK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-554719519166NAC domain-containing protein 19
4dul_A3e-554719519166NAC domain-containing protein 19
1ut7_B3e-554719519166NO APICAL MERISTEM PROTEIN
1ut7_A3e-554719519166NO APICAL MERISTEM PROTEIN
1ut4_B3e-554719519166NO APICAL MERISTEM PROTEIN
1ut4_A3e-554719519166NO APICAL MERISTEM PROTEIN
3swp_D4e-554719522169NAC domain-containing protein 19
3swp_C4e-554719522169NAC domain-containing protein 19
3swp_B4e-554719522169NAC domain-containing protein 19
3swp_A4e-554719522169NAC domain-containing protein 19
3swm_D4e-554719522169NAC domain-containing protein 19
3swm_C4e-554719522169NAC domain-containing protein 19
3swm_B4e-554719522169NAC domain-containing protein 19
3swm_A4e-554719522169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197621e-170FR819762.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC012 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231368.10.0PREDICTED: protein FEZ isoform X2
TrEMBLI1HJC40.0I1HJC4_BRADI; Uncharacterized protein
STRINGBRADI2G25150.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.29e-97NAC domain containing protein 35