PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g24987.1.p
Common NameBRADI_2g24987, LOC100826656
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 309aa    MW: 33733.2 Da    PI: 8.9902
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g24987.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.72.9e-50201441128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeelv++yL+++++g ++++  +i+evd+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nr++ +gyWkatg dk+v 
  Bradi2g24987.1.p  20 LPPGFRFHPTDEELVMHYLCRRCAGLPISV-PIIAEVDLYKYDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRSAGAGYWKATGADKPVG 111
                       79****************************.88***************7666789*************************************9 PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +   +   +kk Lvfy g+apkg kt+W+mheyrl
  Bradi2g24987.1.p 112 T--PTPLAIKKALVFYAGKAPKGDKTNWIMHEYRL 144
                       9..7789**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6017170IPR003441NAC domain
PROSITE profilePS5100558.86420170IPR003441NAC domain
PfamPF023651.0E-2521144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MSGGGGSAGA ASRPGQDLQL PPGFRFHPTD EELVMHYLCR RCAGLPISVP IIAEVDLYKY  60
DPWQLPRMAL YGEKEWYFFS PRDRKYPNGS RPNRSAGAGY WKATGADKPV GTPTPLAIKK  120
ALVFYAGKAP KGDKTNWIMH EYRLADVDRS ARRKNSLRLD DWVLCRIYNK KGVPEQKPSA  180
AKEGSPTHAA VGSPPEQKPA LLQPPPSYAP PPFSELAAYY EVRPSDSMPR AHADSSGSEH  240
HVALTASSCG RGERPEVQSQ PPKISDWERT FSTAGDGSMQ LGQLDPAAGL AAGDPLLQDI  300
LMYWGKPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-771417111166NAC domain-containing protein 19
4dul_A5e-771417111166NAC domain-containing protein 19
1ut7_B5e-771417111166NO APICAL MERISTEM PROTEIN
1ut7_A5e-771417111166NO APICAL MERISTEM PROTEIN
1ut4_B5e-771417111166NO APICAL MERISTEM PROTEIN
1ut4_A5e-771417111166NO APICAL MERISTEM PROTEIN
3swp_D5e-771417114169NAC domain-containing protein 19
3swp_C5e-771417114169NAC domain-containing protein 19
3swp_B5e-771417114169NAC domain-containing protein 19
3swp_A5e-771417114169NAC domain-containing protein 19
3swm_D5e-771417114169NAC domain-containing protein 19
3swm_C5e-771417114169NAC domain-containing protein 19
3swm_B5e-771417114169NAC domain-containing protein 19
3swm_A5e-771417114169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3769310.0AK376931.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3144G06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568425.10.0PREDICTED: NAC domain-containing protein 48
SwissprotQ7F2L31e-146NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLI1HJA30.0I1HJA3_BRADI; Uncharacterized protein
STRINGBRADI2G24987.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34173782
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-107NAC family protein