PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g24790.1.p
Common NameBRADI_2g24790, LOC100821002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 465aa    MW: 51422.1 Da    PI: 4.3724
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g24790.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.41.5e-4961331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhPtd elv++yLk+k+ gkkl + ++i+e+++yk+ PwdLp k ++++++ ew+fF++rdkky++g+r+nrat +gyWk++gkd++
  Bradi2g24790.1.p   6 LPPGFRFHPTDVELVSYYLKRKIMGKKLCV-HAISELELYKFAPWDLPeKsCLRSKDLEWFFFCPRDKKYPKGSRTNRATPNGYWKTSGKDRT 97 
                       79*************************999.88**************95347777888*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +   ++++vglkktL+f++g+apkg++tdWvm eyr+
  Bradi2g24790.1.p  98 IEL-NSRTVGLKKTLIFHEGKAPKGNRTDWVMYEYRM 133
                       ***.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-593156IPR003441NAC domain
PROSITE profilePS5100556.656156IPR003441NAC domain
PfamPF023653.4E-267133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MAQTCLPPGF RFHPTDVELV SYYLKRKIMG KKLCVHAISE LELYKFAPWD LPEKSCLRSK  60
DLEWFFFCPR DKKYPKGSRT NRATPNGYWK TSGKDRTIEL NSRTVGLKKT LIFHEGKAPK  120
GNRTDWVMYE YRMEDDNLVS AGFSKDEYVL CKIFKKSGLG PRIGEQYGAP FDEDDWENLS  180
FETSAFGLVS SEIEDPQAET SVIATATVTQ EPPHQLVRFS GDVNICTNEV NTASVSLSDL  240
EGPHVEASVL ATAAVFEEQP IHSQQSAQCS EHVDTSSSEF NNAPPEDGIF WDELSKFLDN  300
SPHRDIPFGE ESGLPPMSEL EAQAFEINTA DLYNELAGLA GSGGLPIVDF GAIDVGFSLN  360
NFQHTSSEQA VGDDYLELDD LLARDATLSY ELPTPNNEFL QYPLNQSSYG GHYHDGATLS  420
SAFAASGSIP PMPCFFGDVP AVPNNLVNPN YSDSSHSTLK DSFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-52215711169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3621611e-179AB362161.1 Hordeum vulgare subsp. vulgare mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568407.10.0PREDICTED: NAC domain-containing protein 74-like
TrEMBLI1HJ770.0I1HJ77_BRADI; Uncharacterized protein
STRINGBRADI2G24790.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47313664
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.11e-84NAC domain containing protein 103