PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g24040.1.p
Common NameBRADI_2g24040, LOC100833176
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 328aa    MW: 34410.3 Da    PI: 7.673
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g24040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1208.7e-383893661
            zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                       +cprCds ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  Bradi2g24040.1.p 38 PNCPRCDSPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 93
                      68***************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-252283IPR003851Zinc finger, Dof-type
PfamPF027018.2E-323892IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8543892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MLSSHCENML AYAAAAAGRR ASVLVDPRRY RPNVEVAPNC PRCDSPNTKF CYYNNYSLSQ  60
PRYFCKGCRR YWTKGGSLRN VPVGGGCRKN RRGSKSSSSA RPMADDTAAA ARDHGPAPAA  120
FSHRFHGPVR PDMLLEGMVG NPPAQLGQPA PSSANKPAAA ADGSMIDLAL LYSKFLSHQP  180
ANDVRESVDT SSSGSSSATS PGVQPGSGPA QAQAQHGFGR LSSPATASTE QSETTTMLQC  240
ADVRAQALGE LAFSVDQSCY DSLGLPTDGG DLILRSTWDQ GAKYEPFDSL PVPEDAMSLH  300
GGVPAGGDDV WSKVLGSQGL EAALCRP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g24040.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM0843581e-103AM084358.1 Hordeum vulgare subsp. vulgare dof10 gene for dof zinc finger protein 10, exon 1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568362.10.0dof zinc finger protein DOF5.1
TrEMBLI1HJ040.0I1HJ04_BRADI; Uncharacterized protein
STRINGBRADI2G24040.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.11e-27Dof family protein