PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g21880.2.p
Common NameBRADI_2g21880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 407aa    MW: 45737.3 Da    PI: 7.5581
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g21880.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.29e-344397155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      kprl+WtpeLH+rFv+av+qLGG+ekAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Bradi2g21880.2.p 43 KPRLKWTPELHQRFVDAVNQLGGAEKATPKTVMRLMGIPGLTLYHLKSHLQKYRL 97
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.38740100IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-324198IPR009057Homeodomain-like
SuperFamilySSF466898.42E-174298IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-234398IPR006447Myb domain, plants
PfamPF002497.6E-104596IPR001005SANT/Myb domain
PfamPF143799.9E-23144190IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MYHQHQGPSE LFSTRTTFPM ERHLFLHGGS TQDSGLVLST DAKPRLKWTP ELHQRFVDAV  60
NQLGGAEKAT PKTVMRLMGI PGLTLYHLKS HLQKYRLSKN LQAQVNVGTT KNAIGCAVVA  120
DSMPATSTPA MTNTNVIPQA EKTIQIGEAL QMQIEVQRQL NEQLEVQRHL QLRIEAQGKY  180
LQSVLEQAQE SLGKQNLGPA NLEDAKIKIS ELVSQVSNEC FSNAVTDIKE SSRMHRLEPR  240
QIQFVESSTN NCLTAAEGYI NEHRLHSHGV LKAYDDSSIL YRKQSHGHEY QFPLNRSLSE  300
RRMGHLHNVK EYHKAELGSE SDTEIQQEYI TPQKNVGGST TSSASGTKEG DIKKLYLEEP  360
SCKRRAMDYP SFERPNSGKK LDLNTHNTDD SDQGFRHFDL NGFSWS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g21880.2.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024315320.10.0myb-related protein 2-like
RefseqXP_024315321.10.0myb-related protein 2-like
TrEMBLI1HI960.0I1HI96_BRADI; Uncharacterized protein
STRINGBRADI2G21880.20.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122793137
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.32e-99G2-like family protein