PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g21407.2.p
Common NameBRADI_2g21407
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 264aa    MW: 29275 Da    PI: 7.0343
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g21407.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-324599155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      k+rlrWt++LH+rFv+a++qLGG+++AtPk +l +m+v+g+t++hvkSHLQkYRl
  Bradi2g21407.2.p 45 KQRLRWTSDLHNRFVDAIAQLGGPDRATPKGVLTVMGVPGITIYHVKSHLQKYRL 99
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.74242102IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-3143100IPR009057Homeodomain-like
SuperFamilySSF466899.68E-174499IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-2545100IPR006447Myb domain, plants
PfamPF002492.7E-74798IPR001005SANT/Myb domain
PfamPF143795.0E-24132177IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MMYHAKKFSV PFAPQRAQNS EHVSNIGAFG GSNISNPANP VGSGKQRLRW TSDLHNRFVD  60
AIAQLGGPDR ATPKGVLTVM GVPGITIYHV KSHLQKYRLA KYIPESPAEG SKDEKKDSSD  120
SLSNTDSAPG LQINEALKMQ MEVQKRLHEQ LEVQRQLQLR IEAQGKYLQM IIEEQQKLGD  180
SLEGSEERKL SHSPPSLDDY PDSMHPSPKK PRMEDLSPDL ARGVTQPRFE SHLIGPWDQE  240
LCGKNISDPA FQVDEFKANP GLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-2244102159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g21407.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3551770.0AK355177.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1016P09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568204.10.0myb family transcription factor PHL7 isoform X4
SwissprotQ9SJW05e-71PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A0Q3K4E20.0A0A0Q3K4E2_BRADI; Uncharacterized protein
STRINGBRADI2G21407.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.15e-52G2-like family protein