PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g20060.2.p
Common NameBRADI_2g20060, LOC100833785
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TCP
Protein Properties Length: 299aa    MW: 31560 Da    PI: 6.5091
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g20060.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP91.61.7e-2850117370
               TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                       g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl +a ++i++l+ ++++++
  Bradi2g20060.2.p  50 GGKDRHSKVRTVKGLRDRRVRLSVPTAIQLYDLQDRLGLSQPSKVVDWLLDAARREIDKLPPLNFPPP 117
                       78*************************************************************88887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.0E-2651111IPR005333Transcription factor, TCP
PROSITE profilePS5136929.23151109IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MHTNEEPGPD GAANKALLQL HQAASSAASS SSSRQWSAES RIVRVSRVFG GKDRHSKVRT  60
VKGLRDRRVR LSVPTAIQLY DLQDRLGLSQ PSKVVDWLLD AARREIDKLP PLNFPPPDPH  120
AHLMAMAPPP FSATTAAPML VDGDKAAGQL GRCDDGDELK GFMGLRSSLG LVSGAMTPSA  180
LAAHASPYHH QYGAGAEAWS NDAHDYLSGG GRGHNGTDSI QQVATAHGHG HSPYFPSLLS  240
LAPAMSQFVF YSAAEGGFGS AMKEAGDGDD DDQFPVDNLD ASQGQLSLSS DRSFLHSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-1956110155Putative transcription factor PCF6
5zkt_B1e-1956110155Putative transcription factor PCF6
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g20060.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3593596e-75AK359359.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1095A23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566051.10.0transcription factor PCF6
RefseqXP_010231175.10.0transcription factor PCF6
TrEMBLI1HHQ10.0I1HHQ1_BRADI; Uncharacterized protein
STRINGBRADI2G20060.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.14e-36TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5