PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g19930.1.p
Common NameLOC100832233
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 205aa    MW: 21836.6 Da    PI: 9.5605
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g19930.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.35.9e-3764119560
            zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                        l+cprC s++tkfCy+nny+++qPr+fC+aC+ryWt+GGa+rnvPvG+grrkn+ 
  Bradi2g19930.1.p  64 PLPCPRCRSEDTKFCYFNNYNVNQPRHFCRACHRYWTAGGAIRNVPVGSGRRKNRP 119
                       679**************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.7E-3164118IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.39765119IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-2565118IPR003851Zinc finger, Dof-type
PROSITE patternPS01361067103IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MVEMGGGAAA AGFKLFGKVI TRQQQQQPPT RASPDSSSSG GGRGSVEQLE EAARRARAAA  60
GARPLPCPRC RSEDTKFCYF NNYNVNQPRH FCRACHRYWT AGGAIRNVPV GSGRRKNRPV  120
LPHADYQVRL APGPASASAS VEAPDMAPAL GFIPAPEHGW SSLYVVPSPS PAAAAYRGHG  180
AEMEQCWWLV HAERPPLGSS DPAF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g19930.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3123281e-84AJ312328.1 Hordeum vulgare partial dof151 gene for dof zinc finger protein.
GenBankAK3574381e-84AK357438.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1053I13.
GenBankAK3579681e-84AK357968.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1066A04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566046.21e-148dof zinc finger protein 5
TrEMBLI1HHN41e-146I1HHN4_BRADI; Uncharacterized protein
STRINGBRADI2G19930.11e-147(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.18e-32Dof family protein