PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g19480.2.p
Common NameBRADI_2g19480, LOC100826121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 375aa    MW: 38842.5 Da    PI: 6.6189
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g19480.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.34.5e-18253287135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Bradi2g19480.2.p 253 CLHCETDKTPQWRTGPLGPKTLCNACGVRYKSGRL 287
                       99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.50.101.2E-14247284IPR013088Zinc finger, NHR/GATA-type
SMARTSM004014.0E-17247297IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.413247283IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.5E-15249310No hitNo description
CDDcd002021.44E-13252299No hitNo description
PROSITE patternPS003440253278IPR000679Zinc finger, GATA-type
PfamPF003207.4E-16253287IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MEAAAAECAA GGAREKKDAG EIFLVDDLLD LPCDEEEGDE AAAAAEGLDG DCGGGGCGEA  60
GNASGDSSTV TAVDSGNNSL SGLADGDFSG GLCEPYDQLA ELEWVSNYMG DDNLPTEDLR  120
KLQLISGFPS SQLPAAAPRA PAPKLAACAG AGAGAGGALH SEPALVPVPG KARSKRSRVA  180
PCNWSSRLLV LPPAPASPPS PASAVISPSE SGTAFPPFPA KKPAKAAKKK DPLPAAAAPM  240
TAAAMAAAEG RRCLHCETDK TPQWRTGPLG PKTLCNACGV RYKSGRLVPE YRPAASPTFE  300
ASRHSNSHRK VVELRRQKEP PQQQQHLHHH GHQPQPHPGL QVHVPSPLLF DGPLIAGADE  360
FLLRNRIGHH HSYR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g19480.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566028.10.0GATA transcription factor 12
TrEMBLI1HHH60.0I1HHH6_BRADI; Uncharacterized protein
STRINGBRADI2G19480.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.18e-41GATA transcription factor 9