PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g11743.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 413aa    MW: 46484.7 Da    PI: 7.1718
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g11743.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like66.54.5e-21204257155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+rl+Wt+eLH++Fv+a ++L  ++  +Pk+il+lm+ + L++e+v+SHLQkYRl
  Bradi2g11743.2.p 204 KARLVWTEELHNNFVDAYNKL-LPKDRVPKKILRLMNDPRLSRENVASHLQKYRL 257
                       68*******************.88889***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-23201258IPR009057Homeodomain-like
SuperFamilySSF466891.02E-14202257IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-19204258IPR006447Myb domain, plants
PfamPF002497.2E-6207256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MDHVPPAAPG AGGHIPLPLL MHPCPRAIVV SGDASRLHAM ETGLRQEGYK EVETYTDPTV  60
AMAMRRGRYQ LVMVDMFPLR AGALELLECA ISEMNAEAQA LSKVGNRYRK LSIRDLETIR  120
QTIKFNKSTS SEEGTLNHDD DDDDNNNNNS PTSTVSTATI GSSSGRRAPS MKMIRRHEMK  180
SQEVEQDGEH TEAQRQQLTD KSKKARLVWT EELHNNFVDA YNKLLPKDRV PKKILRLMND  240
PRLSRENVAS HLQKYRLNNL VCGEPQPIHR NDLRTQHPKL AQASLLHLNM SQVPSMMTQV  300
PTATSVYMNQ ISNPETTIIT SAKSDTDKKR MDVVVPEKIT TLARSDTNNE RVDAVVLEKM  360
YTGPQVEMEH KVDTEPRQNK IICMLGISDG SFQEDCNDIT QQTWVMNCNR DK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g11743.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233072.30.0two-component response regulator ARR14
TrEMBLA0A2K2D8430.0A0A2K2D843_BRADI; Uncharacterized protein
STRINGBRADI2G11400.12e-80(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01760.13e-17response regulator 14