PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g11400.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 289aa    MW: 32911.4 Da    PI: 10.0499
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g11400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like62.86.7e-20181233154
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                       k rl+Wt+eL ++Fv++ ++L  ++ A+P +il+lm+ + Lt+e+++SHLQkYR
  Bradi2g11400.2.p 181 KVRLVWTEELKKKFVNVYNKL-PPKDAVPTKILKLMNDPTLTRENIASHLQKYR 233
                       67*******************.9999**************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-21178234IPR009057Homeodomain-like
PROSITE profilePS5129410.421178237IPR017930Myb domain
SuperFamilySSF466898.42E-15179234IPR009057Homeodomain-like
TIGRFAMsTIGR015577.9E-18181234IPR006447Myb domain, plants
PfamPF002497.0E-8184233IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MSSMLQPGSP CPRALVVAEY ASRRHAIETR LRLLHGFEVE AYSDPTMAMA MRRGSYQRVM  60
VDMFPLRGGA VELLECAFSE MHADAYALSK VGDSYGPLSM NNIETFKRAI KFHISTSIEA  120
TPNHRSNNSA THTVSTTLSS SRRRATSREM RRQSETKIQE AEQDGEHSEE EQQPVKKESK  180
KVRLVWTEEL KKKFVNVYNK LPPKDAVPTK ILKLMNDPTL TRENIASHLQ KYRNLKHGEA  240
HTIHKNNSRT NHHTSAEGSF LPHNISQQVP HMMIQVQSRE NFQNIFMI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g11400.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024315554.10.0two-component response regulator ARR14-like
TrEMBLA0A2K2D7Z50.0A0A2K2D7Z5_BRADI; Uncharacterized protein
STRINGBRADI2G11400.11e-180(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2089145
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.23e-18response regulator 1