PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g11240.2.p
Common NameBRADI_2g11240, LOC100824494
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 888aa    MW: 98502.5 Da    PI: 7.8226
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g11240.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP120.76.8e-38132207277
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                       Cqv+gC+adl + ++yh+rhkvCevh+k++vv ++ +e+rfCqqCsrfh l efDe+k+sCr+rLakhn rrrk+ 
  Bradi2g11240.2.p 132 CQVDGCHADLRDSRDYHKRHKVCEVHTKSTVVRIKSIEHRFCQQCSRFHLLPEFDEGKKSCRSRLAKHNGRRRKAP 207
                       *************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-30126193IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.846129206IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-35130209IPR004333Transcription factor, SBP-box
PfamPF031101.6E-28132205IPR004333Transcription factor, SBP-box
SuperFamilySSF484035.15E-6618764IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.4E-5618763IPR020683Ankyrin repeat-containing domain
CDDcd002041.03E-4662763No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 888 aa     Download sequence    Send to blast
MEAGFRREGG QTGLANTMSS ELSKNKKKKG LEWDLNDWRW DGNLFLATPS SNAVAAPSGC  60
GSRELGRSED GIDLSVADKR RRVSPVDNHG ECSNAAIANG DHDRVVGRRG QSSREGRHAN  120
ATGAYSTSAP YCQVDGCHAD LRDSRDYHKR HKVCEVHTKS TVVRIKSIEH RFCQQCSRFH  180
LLPEFDEGKK SCRSRLAKHN GRRRKAPAQA GAAGNTSSEN QSLTNTLLLL LKQLSGQDPG  240
SSSEQSNGPN FLVNLLKNLA AIAGTQAYQD MLKNANSASI SSNDANYVVN GFTNEPTRSP  300
IPVGTESSAE HTVKQHVQNF DLNDAYVEED ESRTDKIVFK LFGKEPKDFP VDLRAQMLNW  360
LSHYPSDMES HIRPGCVILT IYLRLPNWMW DKLKVNPAPW IENLISISTD GFWETGWLYT  420
RLQDRLALSC NGRLMLVSPW QPLIGDKHQI LCVTPIATAC SSTANFSVKG FNIVQPTTKL  480
LCIFGGEYLI QEATQMLHED TMMQQGPQCL TFSCSFPSMS GRGFIEVEDY DQSSLSFPIV  540
VAEESLCSEI RMLEDKLNLI AFGDILEGRE DLMASRDQAL NFLQEIGWFL QRSHKRATTD  600
APQYCTESFP VARFRWLLSF AIDQEWCSVV KKLLDTLFQG NIDVDVRSPF EFVLGEGLVF  660
TAVNKRAKRL VEFLLRYTTN SALVARGAVS PVRFLFTPDI TGSSNITPLH IAASMSDGAG  720
VLDALTDDPQ QLGIKAWKHA RDTTGYTPED YAQKRGHISY IQMVENKINS RLPKAHVSVS  780
MTISPSTTDI SEKHAGRSKS TNQTTLDIEK SQRSDKRPPS CRQCVQLQHI AYHPRPNRFL  840
SNRPAVLSLV AIGAVCVCVG LIMQSPPTVG VGMTGPFLWS SLNYGPI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-26126205584squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17882KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g11240.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567564.10.0squamosa promoter-binding-like protein 1 isoform X1
SwissprotQ9LGU70.0SPL1_ORYSJ; Squamosa promoter-binding-like protein 1
TrEMBLA0A0Q3FX420.0A0A0Q3FX42_BRADI; Uncharacterized protein
STRINGMLOC_34539.40.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Representative plantOGRP25951432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.11e-180squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang H,Zhai J,Mo J,Li D,Song F
    Overexpression of rice sphingosine-1-phoshpate lyase gene OsSPL1 in transgenic tobacco reduces salt and oxidative stress tolerance.
    J Integr Plant Biol, 2012. 54(9): p. 652-62
    [PMID:22889013]
  3. Zhang H, et al.
    Molecular characterization of rice sphingosine-1-phosphate lyase gene OsSPL1 and functional analysis of its role in disease resistance response.
    Plant Cell Rep., 2014. 33(10): p. 1745-56
    [PMID:25113543]