PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g11163.1.p
Common NameBRADI_2g11163
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 188aa    MW: 21293.8 Da    PI: 10.3195
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g11163.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.23.4e-161050242
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                      ri n+  r  tf +R   + KKA+ELS+LC+++++vi++++
  Bradi2g11163.1.p 10 RIPNDAARRATFRNRHDVLVKKASELSTLCNIKACVIVYGE 50
                      899************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.7E-18160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.596150IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-20295IPR002100Transcription factor, MADS-box
CDDcd002664.12E-23282No hitNo description
PRINTSPR004047.5E-8323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-141050IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MGRKKVSLQR IPNDAARRAT FRNRHDVLVK KASELSTLCN IKACVIVYGE GEAQPEVWSF  60
VDEVVPILHR YKAMPEIGQC KKTVTQEDFL RQRIDKLKRQ VHKAVQENRE LDTACLVHKA  120
MLGHLPRLEG LTVEEAANVG WMVQMKIKSL GDRIANLQAH AWLQLYAQPA PSVMYAQQAI  180
RRLGSTR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g11163.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693109e-36KF469310.1 Brachypodium distachyon MADS-box transcription factor 15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024314493.11e-100agamous-like MADS-box protein AGL80
TrEMBLA0A0Q3FX611e-137A0A0Q3FX61_BRADI; Uncharacterized protein
STRINGGRMZM5G853066_P012e-56(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-28AGAMOUS-like 80