PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g10745.1.p
Common NameBRADI_2g10745
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 257aa    MW: 27922.7 Da    PI: 8.2342
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g10745.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.51.7e-131050242
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                      ri n+  r++tf +  n + KKA+ELS+ C+++ +vi++++
  Bradi2g10745.1.p 10 RIPNDAARSTTFRNLHNDLVKKASELSTFCNVNTCVIVYGE 50
                      899************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-8160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.666150IPR002100Transcription factor, MADS-box
CDDcd002663.01E-15260No hitNo description
SuperFamilySSF554551.57E-15390IPR002100Transcription factor, MADS-box
PfamPF003193.5E-121050IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MARKKATPRR IPNDAARSTT FRNLHNDLVK KASELSTFCN VNTCVIVYGE GEAQPKVWPS  60
VDEAVPILHR YKAMTEEGFL RQRMDKLREQ VHKARHENRE LHTACLVHKA MLGRLPGLKG  120
LTVEEVANVG WMVQMKLKSI GDRIANLQAQ AALQLQAQPA PPLTYAGAVA GDLARHGEAP  180
LVQGGFIGGN DASSSTADNM ASTSASAGFS WQWPDDTGDS SSSFHPNIFV VAADARSPCN  240
ADRGCVEVLV WYMQLT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g10745.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565667.11e-169agamous-like MADS-box protein AGL80
TrEMBLA0A0Q3MHL80.0A0A0Q3MHL8_BRADI; Uncharacterized protein
STRINGSi019470m5e-57(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-21AGAMOUS-like 80