PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g10640.1.p
Common NameBRADI_2g10640, LOC100837366
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 488aa    MW: 53276.2 Da    PI: 7.2977
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g10640.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.13e-36106165362
            zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       + +++cprC+s++tkfCy+nny++sqPr++C++C+ryWt+GG +rnvPvG+grr+nk++s
  Bradi2g10640.1.p 106 DIIVPCPRCNSMETKFCYFNNYNVSQPRHYCRNCQRYWTAGGNIRNVPVGSGRRRNKHAS 165
                       56789****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-28102162IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.969109163IPR003851Zinc finger, Dof-type
PfamPF027019.0E-31109163IPR003851Zinc finger, Dof-type
PROSITE patternPS013610111147IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MAAIRDRGDA AIKLFGRTIP LLHAAAAATE VVTKLRIDEN KNDAVPCVSD KLLNVKETPF  60
CSKNSEDNDL QALSRHGGIM GTDSKSEDTK TESDELDQDK VLKKPDIIVP CPRCNSMETK  120
FCYFNNYNVS QPRHYCRNCQ RYWTAGGNIR NVPVGSGRRR NKHASHFRQA MMRHDNNIAA  180
AEDVPSVIHH LPLPLVAPVL PGPIKENETA KEFGSEVPVC NSMATVLDNG EQKGIHLVPL  240
VSGDNKEEQS CASSAAVLGC SENMTLDSIV KKESGNVSGY CNGMTLPQSH VQSYPNGPAL  300
VFPWSPGWNS IAVMAASQCS TEPVHGLEIA KHSLLSWAPP SMMTAPGICA PVVPFPLMPP  360
FWSCLPGWPN GTWSSPWPGS NGSPNKITCS ENNSPTLGKH SREVADMQEE EKRENTLWIP  420
KTRRIDGTAE ATKSSILDTL GIKHDENGLF KSFQRKVPKN DKTPDSPLTL QANPAAFSRS  480
QSFQERT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g10640.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565663.10.0cyclic dof factor 2
TrEMBLI1HEI70.0I1HEI7_BRADI; Uncharacterized protein
STRINGBRADI2G10640.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-57cycling DOF factor 2