PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g09720.1.p
Common NameBRADI_2g09720, LOC100820888
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 549aa    MW: 59270.1 Da    PI: 4.6839
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g09720.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.7e-39166225261
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       ++k+++cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+s
  Bradi2g09720.1.p 166 PDKIIPCPRCNSMDTKFCYYNNYNINQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKSKNS 225
                       7899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1014473.4E-64049No hitNo description
ProDomPD0074787.0E-31163223IPR003851Zinc finger, Dof-type
PfamPF027017.2E-32168224IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.696170224IPR003851Zinc finger, Dof-type
PROSITE patternPS013610172208IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MMSDQMDSGI KLFGRVIPLA PEAASGPPEA DAAAGSDHPP PPPPPPPPPP ELQTAAPAEE  60
AEEEAHKDQH KETEDKEDSE MKVDVPPEKE NRGIEGDAPR EKEGNEMEVD APQVNENAEP  120
DSSSTLDHKK DTQDQINSAE DKADPKELNE KTANEESDQD KVLKKPDKII PCPRCNSMDT  180
KFCYYNNYNI NQPRHFCKNC QRYWTAGGTM RNVPVGAGRR KSKNSSLHYR QLLMAPDCMM  240
GSRVDISNTV NPEVLASLPT TPTKSTSRNE TVLKFGPEVP LCESMASVLN IEEQNVINAG  300
SVPIGEAREV NSCASSMTSH NGLPENAVHV DKNGAPVYCG GVGPMPPYYL GAPFMYPWSI  360
GWNNLPVMVP GGSMSESASP SESCSTSSAP WMNSPMMPGS RLPAPAFPYP LVPPTLWGCL  420
PSWPATAWNA PWIGTNGCIS PSTSSNSSCS GNGSPTLGKH SRDSNPLKDD KEEKSLWVPK  480
TLRIDDPDEA AKSSIWATLG IKPGDPGVFK PFQFKSENKG QTTDVRPACV LQANPAAFSR  540
SQSFQESS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g09720.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565622.20.0cyclic dof factor 2
TrEMBLA0A0Q3JZ270.0A0A0Q3JZ27_BRADI; Uncharacterized protein
STRINGBRADI2G09720.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-67cycling DOF factor 2