PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g05794.1.p
Common NameBRADI_2g05794, LOC106865987
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 243aa    MW: 25263 Da    PI: 9.3134
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g05794.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.23.2e-373691358
            zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58
                       + l+cprC+st+tkfCyynny+l+qPr+fCk+CrryWt GGalrnvPvGg++r +
  Bradi2g05794.1.p 36 AERLACPRCESTDTKFCYYNNYNLQQPRHFCKGCRRYWTVGGALRNVPVGGATRSK 91
                      67899************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.2E-313891IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.6983993IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-223989IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104177IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MVLITAMDHQ QLAEEAAAAE GMVVRTSAAA AAGRPAERLA CPRCESTDTK FCYYNNYNLQ  60
QPRHFCKGCR RYWTVGGALR NVPVGGATRS KAGLVPASRR KRSSSSNSHH AAPAPPMASL  120
PVPVPAPVRP LSVSAPLPLP LLPPAPGTMQ AYELSFIPAG LQLHAASMVD PDRRLLDLGG  180
SFSSLLAPPP PQPPLHFGGF LLGGGGSGSA GLAHAPAGLQ QQPVSQALPE GFWGMGWPDL  240
SI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g05794.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0025372e-53AP002537.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0001B06.
GenBankAP0027462e-53AP002746.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0671B11.
GenBankAP0149572e-53AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126092e-53CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankGQ1835472e-53GQ183547.1 Oryza sativa Japonica Group Dof-type zinc finger protein 18 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753871.11e-174dof zinc finger protein DOF3.1
TrEMBLA0A0Q3QNU61e-172A0A0Q3QNU6_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.31e-29Dof family protein