PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g04270.2.p
Common NameBRADI_2g04270, LOC100844272
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 266aa    MW: 26990.6 Da    PI: 7.7176
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g04270.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.94.3e-44301291100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasnv+kll++l +++reda+ssl+yeAear++dPvyG+vg i+ lq+q+++l+++
  Bradi2g04270.2.p  30 PCAACKFLRRKCLPGCVFAPYFPPEEPQKFANVHKVFGASNVTKLLNELLPHQREDAVSSLAYEAEARVKDPVYGCVGAISVLQRQVHRLQKD 122
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       l+++++e
  Bradi2g04270.2.p 123 LDAAHSE 129
                       **99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.3929130IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-4330127IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MASPSSTGNS GVSVVAAASA SASTPGAGSP CAACKFLRRK CLPGCVFAPY FPPEEPQKFA  60
NVHKVFGASN VTKLLNELLP HQREDAVSSL AYEAEARVKD PVYGCVGAIS VLQRQVHRLQ  120
KDLDAAHSEL LRYACADVVI PTALPVVNAR LAAASAAMPC PGTQLSAGIY GGGRRLGLGV  180
GVGGLVDAIA PPMPPSSSAG CYYMRSTTNN NNNAPGGGVS GVDVAPVQIP YASMANWAVN  240
AISTTTASGS ESIGMDHKEG GDSSM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-82201491131LOB family transfactor Ramosa2.1
5ly0_B4e-82201491131LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi2g04270.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE6508360.0HE650836.1 Brachypodium sylvaticum genomic construct, BACs 73P1 and 17E7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230496.10.0LOB domain-containing protein 6
RefseqXP_014753892.10.0LOB domain-containing protein 6
TrEMBLI1HCD90.0I1HCD9_BRADI; Uncharacterized protein
STRINGBRADI2G04270.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88133545
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.44e-63LBD family protein