PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g78540.1.p
Common NameBRADI_1g78540, LOC100846147
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 355aa    MW: 37620.3 Da    PI: 7.2727
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g78540.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.67.3e-18256290135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  Bradi1g78540.1.p 256 CTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRL 290
                       *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.411250286IPR000679Zinc finger, GATA-type
SMARTSM004016.8E-16250300IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.3E-13254288IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577163.18E-14254314No hitNo description
CDDcd002025.91E-14255302No hitNo description
PfamPF003201.1E-15256290IPR000679Zinc finger, GATA-type
PROSITE patternPS003440256281IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MAQEWEAAMG MELGMGTTPH YAASPAAAAA ATMAAPFGHG SAYSHSLPHH YHFYGGSGAE  60
VADPMRVDEM LDLSSHLGAH DFFPGGSNGA AQGEQAPPPA APSSSDHHGH GHHHSSSNSF  120
NLSFADEFFV PVPREEAAEL EWLSNFVDDS YPDTPNYPPA VQAAARNGAR QEMLHNNNNP  180
ASTALPGRGA RSKRSRAASA AAAAWHALVP RHQEHQRPSP SSSSSSSDQQ QLVSSSKPAR  240
PKAELGSEEQ GGVRRCTHCA SEKTPQWRTG PLGPKTLCNA CGVRYKSGRL VPEYRPAASP  300
TFVLTQHSNS HRKVMELRRQ NEQLVHIRGG AAAGSPSSGS AASGEHMFRD YGVC*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g78540.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3580341e-82AK358034.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1067G03.
GenBankAK3658411e-82AK365841.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2038D02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559045.10.0GATA transcription factor 2
SwissprotO497411e-59GATA2_ARATH; GATA transcription factor 2
TrEMBLI1HAW60.0I1HAW6_BRADI; GATA transcription factor
STRINGBRADI1G78540.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46212955
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.14e-51GATA transcription factor 2
Publications ? help Back to Top
  1. Jiang K,Yung V,Chiba T,Feldman LJ
    Longitudinal patterning in roots: a GATA2-auxin interaction underlies and maintains the root transition domain.
    Planta, 2018. 247(4): p. 831-843
    [PMID:29249045]