PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g77217.1.p
Common NameBRADI_1g77217, LOC100843938
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 711aa    MW: 78416.1 Da    PI: 5.3694
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g77217.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.41.1e-5661331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhPtdeel+ +yLk+k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++
  Bradi1g77217.1.p   6 LPPGFRFHPTDEELIIYYLKRKINGRQIEL-EIIPEVDLYKCEPWDLPeKsFLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRK 97 
                       79****************************.99**************95334455777*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       v s ++++vg+kktLv+y+grap+g++tdWvmheyrl
  Bradi1g77217.1.p  98 VNS-QRRAVGMKKTLVYYRGRAPHGSRTDWVMHEYRL 133
                       ***.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-634156IPR003441NAC domain
PROSITE profilePS5100561.3316156IPR003441NAC domain
PfamPF023651.7E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 711 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI IYYLKRKING RQIELEIIPE VDLYKCEPWD LPEKSFLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QRRAVGMKKT LVYYRGRAPH  120
GSRTDWVMHE YRLDECECEI DNGLQDAYAL CRIFKKTAPG PKIIEHYGAV QYHAEQPQWG  180
TSCSVERSPT LDVSCDGRGG ADEFETSSFS FPTEAAPMAS SSMHGGCGFG MPMMSGGAPQ  240
EDGRWMQFLS EDAFNATNPF FMNPASASNF SCFPSKVDVA LECARLQYRL DLPPPLEVED  300
FPQDVSLDTK TGILRSNPNE VDILQEFLSV ASASQELING SSSSYTETWL GGAGTSSAGN  360
HYMNELSSLV DLGATKAKEE ADNFYQLCSI GASMTSRDEP ARLVEISDME EFKEEKRRVE  420
NLRGVKLVNN DLGEIVVEGD ENNQTEVITH YPIKDAADTS GEAGHHLTDA TDAVGIDDTA  480
PIFSQSQPDD FAIIAAAGFH DEEGENASLD LYDKQVVDVQ HGLFVSRVGA AETFFHRVEP  540
PNKVSFHLNP AANSSVGVGK AISEKIHCSY HYLPVTSKVS GSNKVSSIFS KVKALVRDKF  600
MARKPSLSLH RRRSEETATV SELLQIVSLL LAAPSSNKEV TEQGDLVARK KAKEPVMMKP  660
PVWGCDDGCS NPWLPKRNNN KGISGMFLSG KWAFLTSALL AIRAPAGSCN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-55116212171NO APICAL MERISTEM PROTEIN
1ut4_B6e-55116212171NO APICAL MERISTEM PROTEIN
1ut7_A6e-55116212171NO APICAL MERISTEM PROTEIN
1ut7_B6e-55116212171NO APICAL MERISTEM PROTEIN
3swm_A7e-55116215174NAC domain-containing protein 19
3swm_B7e-55116215174NAC domain-containing protein 19
3swm_C7e-55116215174NAC domain-containing protein 19
3swm_D7e-55116215174NAC domain-containing protein 19
3swp_A7e-55116215174NAC domain-containing protein 19
3swp_B7e-55116215174NAC domain-containing protein 19
3swp_C7e-55116215174NAC domain-containing protein 19
3swp_D7e-55116215174NAC domain-containing protein 19
4dul_A6e-55116212171NAC domain-containing protein 19
4dul_B6e-55116212171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g77217.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562178.10.0uncharacterized protein LOC100843938 isoform X2
TrEMBLI1HAF20.0I1HAF2_BRADI; Uncharacterized protein
STRINGBRADI1G77217.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP66243651
Representative plantOGRP87171015
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-125NAC domain containing protein 28