PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g76732.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 412aa    MW: 45499.6 Da    PI: 5.3866
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g76732.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.91.1e-54551841129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL +     ++e++ewyfFs +d+ky+tg+r+nrat +g+Wkatg+dk
  Bradi1g76732.2.p  55 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLTEhcgIGYEEQSEWYFFSFKDRKYPTGTRTNRATMAGFWKATGRDK 146
                       69****************************.9***************853542334667********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +v++ +++l+g++ktLvfykgrap+g+ktdW+mheyrle
  Bradi1g76732.2.p 147 AVHE-RSRLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 184
                       ***9.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.12E-5951204IPR003441NAC domain
PROSITE profilePS5100559.08155204IPR003441NAC domain
PfamPF023652.5E-2856183IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MESPGHAELS SAMESVDKGR QGGQRPRQGK PTVERSGGGG GDHSCARMDS MESCVPPGFR  60
FHPTDEELVG YYLRKKVASQ KIDLDVIRDI DLYRIEPWDL TEHCGIGYEE QSEWYFFSFK  120
DRKYPTGTRT NRATMAGFWK ATGRDKAVHE RSRLIGMRKT LVFYKGRAPN GQKTDWIMHE  180
YRLETDENAP PQEEGWVVCR AFKKRAAYPS RGMGMAMAER WDSNYSSSPY HDAASGMAAA  240
FADHPASYAR SARFKAEDDG AAQLLRYTSS HLVELPQLES PSAMPPALPP ATKKKTKNGR  300
KLPEEQEDRD QDEAGGGMVT ADWRALDKFV ASQLSPGGAQ LDQAPPPAGA SSQSAQPELE  360
REREDQDDMA ALLFLNNDER DEMERWTGLL ASASGAGAGG DGDLGICVFD K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-505220512169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934220.0JQ693422.1 Brachypodium distachyon SWN1 (SWN1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266879.10.0uncharacterized protein LOC100835498
RefseqXP_014755549.10.0PREDICTED: uncharacterized protein LOC100835498 isoform X1
RefseqXP_014755664.10.0PREDICTED: uncharacterized protein LOC100835498 isoform X1
SwissprotQ9SL411e-125NAC37_ARATH; NAC domain-containing protein 37
TrEMBLI2E2W10.0I2E2W1_BRADI; SWN1
STRINGMLOC_56769.11e-175(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36253768
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-113vascular related NAC-domain protein 1