PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g73710.1.p
Common NameBRADI_1g73710, LOC100825862
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 435aa    MW: 47190.7 Da    PI: 8.1988
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g73710.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.2e-3999158261
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrk+k+ 
  Bradi1g73710.1.p  99 PDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKKCQRYWTAGGAMRNVPVGAGRRKSKSI 158
                       7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3095156IPR003851Zinc finger, Dof-type
PfamPF027013.4E-32101157IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.686103157IPR003851Zinc finger, Dof-type
PROSITE patternPS013610105141IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MGQCRAAAGG GDCLFKLFGK TIPVPADSSG SVVDKDQQHS GSSTAEPKVQ ENIPGDSTGS  60
PTLPEVVDTD DSCAVKKSSA DQEEEQSDTA NQKEKLKKPD KILPCPRCNS MDTKFCYYNN  120
YNINQPRHFC KKCQRYWTAG GAMRNVPVGA GRRKSKSISA ASHFLQRIRA TLPGDPLCTP  180
IKTNATVLSF GSDTSTLDLT EQMKHLKDKL IPVTQIKNTD DPSVGSCAEG WAKGEEQNQM  240
NSREEVTADK STNVAQHPCM NGGTMWPFSC APSPAYFTSS VAIPFYPAAA AAAYWGYMVP  300
GAWNTPWPPQ SQSQSSSSPN AASPVSTMSS CFQSRKHPRD GDEERDTNRN GKVWVPKTIR  360
IDDADEVARS SIWSLIGING DKVGTDDGRG CKITRVFYPK DEAKTTTHRV NNSLPFLKGN  420
PAALSRSVTF QERS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g73710.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2529240.0AK252924.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf174o03, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558722.10.0cyclic dof factor 1
TrEMBLI1H9950.0I1H995_BRADI; Uncharacterized protein
STRINGBRADI1G73710.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.16e-64cycling DOF factor 3