PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g71930.1.p
Common NameBRADI_1g71930, LOC100821748
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 316aa    MW: 34112.7 Da    PI: 4.7102
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g71930.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.71.9e-1856107556
                       SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++  eq+++Le+ Fe +++++ e+++++A+ l L+ rqV vWFqNrRa++k
  Bradi1g71930.1.p  56 RRLALEQVRALERSFEVDNKLDPERKARIARDLALQPRQVAVWFQNRRARWK 107
                       467789*********************************************9 PP

2HD-ZIP_I/II125.91.8e-4054145293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       kkrrl+ eqv++LE+sFe ++kL+perK+++ar+L lqprqvavWFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++++L++e++e
  Bradi1g71930.1.p  54 KKRRLALEQVRALERSFEVDNKLDPERKARIARDLALQPRQVAVWFQNRRARWKTKQLERDFNALRARHDALRSDCDALRRDKDALAAEIRE 145
                       9**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-1848111IPR009057Homeodomain-like
SMARTSM003893.8E-1752113IPR001356Homeobox domain
PROSITE profilePS5007116.26154109IPR001356Homeobox domain
CDDcd000863.49E-1754110No hitNo description
PfamPF000468.9E-1656107IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-1861108IPR009057Homeodomain-like
PROSITE patternPS00027084107IPR017970Homeobox, conserved site
PfamPF021831.2E-16109150IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MKRQSKRLTS GGQESPEPGD QSLLPPYMEH DEADLEEEDE EEERGSLSCG LGGKKRRLAL  60
EQVRALERSF EVDNKLDPER KARIARDLAL QPRQVAVWFQ NRRARWKTKQ LERDFNALRA  120
RHDALRSDCD ALRRDKDALA AEIRELREKL PKPEAAAVKS EACIEAELRQ ATAVGAAVCN  180
NNKDGSSDSD SSVVFNDEAS PCPYSGSAAV FEQPGGGFMG FGAPTFLDSS AAATGGCSSS  240
LLPMLETKWP GAYGSYDAGK SGGGYGFTEE WLAGTDAIGN DAGAGFFADE HVSSLNFGWC  300
GSGAEGFDLH GYCKK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101109RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g71930.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3539651e-125AK353965.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1004B20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558624.10.0homeobox-leucine zipper protein HOX13
SwissprotQ10QP31e-101HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLI1H8S40.0I1H8S4_BRADI; Uncharacterized protein
STRINGBRADI1G71930.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Representative plantOGRP1414944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.23e-34homeobox protein 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]