PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g71910.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 339aa    MW: 36948.9 Da    PI: 9.0309
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g71910.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.26e-311972255
           G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      prlrWtp LH++Fv+a+++LGG+++AtPk++l+lm+v gLt++hvkSHLQ+YR 
  Bradi1g71910.3.p 19 PRLRWTPALHRCFVHAIRSLGGQHRATPKRVLQLMGVGGLTISHVKSHLQMYRN 72
                      8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-291574IPR009057Homeodomain-like
PROSITE profilePS5129413.2711575IPR017930Myb domain
SuperFamilySSF466895.73E-151773IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-231972IPR006447Myb domain, plants
PfamPF002497.9E-82071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MSMARTMAGV RQYKRSKVPR LRWTPALHRC FVHAIRSLGG QHRATPKRVL QLMGVGGLTI  60
SHVKSHLQMY RNMRTDLGMQ GMMQAQQWDQ EHTYGGMEVC ITDTQQQHRD HECDVPFYDS  120
PKPRKEPLLL LHPNLKRTAA SETTEARRER HGEEDAGASP TSLLGSGQRE GIRERDRTSS  180
SSSRLHCCGL GYVQPRAPGI KQKRLQRELW MPPELHGDAQ HAVPSGLEFL GFLVAPPAAC  240
RRGLPFEVCT VSGQPFEPTS FSAKKFEQPT STIRPAGFVN PASPAADHDD GCSLSLSLAL  300
ALCPGAGSGC RQVASSTASS SSAASQISLD LSLSTLDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-182074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-182074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-182074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-182074357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g71910.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0689103e-68BT068910.1 Zea mays full-length cDNA clone ZM_BFc0191L18 mRNA, complete cds.
GenBankHQ8587023e-68HQ858702.1 Zea mays clone UT1158 G2-like transcription factor mRNA, partial cds.
GenBankKJ7268133e-68KJ726813.1 Zea mays clone pUT3230 G2-like transcription factor (GLK48) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230232.20.0uncharacterized protein LOC104582408
TrEMBLA0A2K2DUQ40.0A0A2K2DUQ4_BRADI; Uncharacterized protein
STRINGBRADI1G71910.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76102950
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.13e-29G2-like family protein