PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g69150.1.p
Common NameBRADI_1g69150, LOC100839337
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 276aa    MW: 29736.3 Da    PI: 6.7769
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g69150.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74.2e-18109163256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ ++tkeq   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Bradi1g69150.1.p 109 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTK 163
                       788899***********************************************98 PP

2HD-ZIP_I/II125.42.6e-40109198191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +kk+rl+keq++lLE+ F+e+++L+p++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL++e +eLr +l
  Bradi1g69150.1.p 109 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQRELHELR-AL 198
                       69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-18101164IPR009057Homeodomain-like
SuperFamilySSF466897.7E-19103166IPR009057Homeodomain-like
PROSITE profilePS5007117.232105165IPR001356Homeobox domain
SMARTSM003897.8E-16107169IPR001356Homeobox domain
PfamPF000461.9E-15109163IPR001356Homeobox domain
CDDcd000861.95E-15109166No hitNo description
PROSITE patternPS000270140163IPR017970Homeobox, conserved site
PfamPF021837.9E-11165199IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.4E-23165208IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MAQEEVHDAG LALGLSLGGG GGGDSSRRRR REASSSQQCP LEPSLTLSMP DDAATLSGGG  60
VSSMSAVKRE RAEEEEEEEA AEMVSSTALQ AAFGGAGAGA EEDDDGSTRK KLRLTKEQSA  120
LLEDRFKEHS TLNPKQKVAL AKQLNLRPRQ VEVWFQNRRA RTKLKQTEVD CEFLKRCCEN  180
LTEENRRLQR ELHELRALKF APPPPPPPLS AAAAPPPFYM QLPAATLTIC PSCERLGGST  240
AANATNNTSK AVDSDVRPKG GTHHFFNPFT HSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1107113TRKKLRL
2157165RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g69150.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0977881e-154FP097788.1 Phyllostachys edulis cDNA clone: bphylf059k15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558432.10.0homeobox-leucine zipper protein HOX19
SwissprotA2XE761e-102HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL41e-102HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLI1H7T30.0I1H7T3_BRADI; Uncharacterized protein
STRINGBRADI1G69150.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-64homeobox from Arabidopsis thaliana