PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g66597.1.p
Common NameBRADI_1g66597, LOC100831100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 409aa    MW: 42151.6 Da    PI: 9.8406
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g66597.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.21.8e-3890150262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       +e alkcprCdstntkfCyynnyslsqPr+fCkaCrryWt+GGalr vPvGgg+r+nk+ss
  Bradi1g66597.1.p  90 PEPALKCPRCDSTNTKFCYYNNYSLSQPRHFCKACRRYWTRGGALRSVPVGGGCRRNKRSS 150
                       56789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3472143IPR003851Zinc finger, Dof-type
PfamPF027019.9E-3393148IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.55394148IPR003851Zinc finger, Dof-type
PROSITE patternPS01361096132IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MVFPSVPAYL DPPNWNNQQG QQPRASGAGG GGGSAGDAAQ HMPPVGPTAA ALASSSAAGN  60
NEAAGQQQQQ ARPNSHSMTE RARMARAPHP EPALKCPRCD STNTKFCYYN NYSLSQPRHF  120
CKACRRYWTR GGALRSVPVG GGCRRNKRSS NKSSKPSSSS ANRQQLPGGA SASSSILPST  180
APGSGVPSGA MIPPVGLGSS MAHHLPFLGS MQQHAPGAGP NLGLAFSVGL PPLGIGMHQQ  240
QHMDGVDQSS FPLASGGAAA TFGASLEQQW RVQQQQPHQQ QFPFLELPPP PMYQLGALQA  300
NRAAGSGAAA PSGMFTLGQT AASATATAAR HERSVKQADD DSKGGQQEMS LQRQYMEALR  360
QQGDHQAQGV WGGSGSATDD GNNGSGSWTM NLPGFHSSST GGHGGGLL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g66597.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0839424e-83AC083942.8 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0002D01, from chromosome 3, complete sequence.
GenBankAC1376984e-83AC137698.1 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBb0014A21, from chromosome 3, complete sequence.
GenBankAP0149594e-83AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126114e-83CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561779.10.0dof zinc finger protein DOF5.1
TrEMBLI1H6Y40.0I1H6Y4_BRADI; Uncharacterized protein
STRINGBRADI1G66597.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123012432
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.17e-38Dof family protein