PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g63530.3.p
Common NameBRADI_1g63530, LOC100833923
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 453aa    MW: 49770.1 Da    PI: 6.6172
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g63530.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.47.6e-34233287155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+r+rWtpeLHe+Fv+av++LGGsekAtPk +l+lmkv++Lt++hvkSHLQkYR+
  Bradi1g63530.3.p 233 KQRMRWTPELHECFVDAVNKLGGSEKATPKGVLKLMKVDSLTIYHVKSHLQKYRT 287
                       79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.488230290IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-31231289IPR009057Homeodomain-like
SuperFamilySSF466896.27E-18232287IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-26233287IPR006447Myb domain, plants
PfamPF002491.4E-9235286IPR001005SANT/Myb domain
PfamPF143792.2E-24316362IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MRKCDLRHSH NNRVSGAMSS SLPILPNSLK ENFPRSHNPQ LIPMPRQLMN DSVPLHHSAP  60
QSATLHPRAG VMRSSYSASL GFSASPADSV PNHESQSMSA PFISQPLDIE LFQTLSDNIP  120
GGHTEATWFP GSVDGLTDYG DNVGAPGNQI RNGCPAVTSD VVAKQNEWWE EIMDDDWRGI  180
LDATTTDSQS KAMIQTSNSA VSQPAVNQSA SSHSGEMCNV ASPPNGNNVS AAKQRMRWTP  240
ELHECFVDAV NKLGGSEKAT PKGVLKLMKV DSLTIYHVKS HLQKYRTARY KPDLSEGTTE  300
KRTSTEELTL DLKSSMDLTE ALRLQMEVQK RLHEQLETQR KLQLRIEEQG KYLQMMFEKQ  360
SKSSTENVQD LSGNTAAPSS DLSHSVNRNR DSEAAEDPNR TGDNPGSVKS GEYSTHTSGN  420
QRTAERDSSD PLANTNDGLK APQEKRRRVH DS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-29232291160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-29232291160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-29232291160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-29232291160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-29232291160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-29232291160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-29232291160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-29232291160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1444448KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g63530.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228678.10.0protein PHOSPHATE STARVATION RESPONSE 1
RefseqXP_024312499.10.0protein PHOSPHATE STARVATION RESPONSE 1
SwissprotB8ANX90.0PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLI1H5W40.0I1H5W4_BRADI; Uncharacterized protein
STRINGBRADI1G63530.20.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.14e-68phosphate starvation response 1