PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g58830.1.p
Common NameBRADI_1g58830, LOC100838028
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 348aa    MW: 36538.3 Da    PI: 9.2045
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g58830.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.22.4e-30228282156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k+r++W+peLH++Fv+a++qLGG++ AtPk+i+e m+v+gLt+++vkSHLQkYRl+
  Bradi1g58830.1.p 228 KARRCWSPELHRKFVNALNQLGGPH-ATPKQIRERMQVDGLTNDEVKSHLQKYRLH 282
                       68*********************98.****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.511225284IPR017930Myb domain
SuperFamilySSF466898.24E-18226285IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-28226285IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-25228282IPR006447Myb domain, plants
PfamPF002492.0E-8230280IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGLEAGESAM GGDLSLDLQA FAARTVAGRI PAASREDVLR KLEEEKGKIE VFGRELPVCV  60
RLIAAVIDLL KEKVESNGGD HRDEAEGSGD KSSWMSSAQL WIGGGSSKAP EKEGRSSAPE  120
KRALGGGLGF GPFKAVGSGG PAFLPVSLRK EAPLRIPDLP FLSSGSLKIN SPAPAAAASA  180
SAGLQVAGFG LDAARTAAIA APQLTLQTQP QPQQVAQQTA QQQQQARKAR RCWSPELHRK  240
FVNALNQLGG PHATPKQIRE RMQVDGLTND EVKSHLQKYR LHTSRMVSGG PLMHHRPVVL  300
SGGLWMLPSE ESSSLSGSPP GPLSGMAVSS AVSGEDDDGR SQSHGWM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g58830.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557660.10.0transcription factor NIGTH1 isoform X2
TrEMBLI1H4790.0I1H479_BRADI; Uncharacterized protein
STRINGBRADI1G58830.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Representative plantOGRP25631133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.19e-43G2-like family protein