PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g58087.1.p
Common NameLOC100828457
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 981aa    MW: 107908 Da    PI: 7.8014
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g58087.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.74.7e-07317408146
                       TSSS-HHHHHHHHHHHHHTTTT..............................................-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..............................................tWktIartmgkgRtlkqcksrwqk 46 
                       +++W+  E + l+++vkq   +                                              +W++Ia++   gR++ +c srw++
  Bradi1g58087.1.p 317 KQSWSDMEKDSLAKGVKQQYQEiliknsmkngsstgdfsaldiacamtntagnfevppeilrsvlplvNWDKIAAMYLPGRSGAECESRWLN 408
                       689***************9999****************************************************99888***********98 PP

2Myb_DNA-binding25.14e-08417461246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++WT+ E++ l+  v++ G+++W  Ia  +g+ Rt+ qc  r+q 
  Bradi1g58087.1.p 417 NAWTAHEEKTLILTVQEKGMHNWINIAVALGTQRTPFQCLARYQR 461
                       58*****************************99**********96 PP

3Myb_DNA-binding45.51.7e-14470514248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         WT+eEd++l+ av+ +G + W ++++ m  gR ++qc +rw+k l
  Bradi1g58087.1.p 470 RVWTKEEDLQLLAAVETFGCN-WQLVSASMD-GRIGNQCSNRWRKTL 514
                       57*****************88.*********.************975 PP

4Myb_DNA-binding445.2e-14522567248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       grW+++Ed++l   vk++G+g+W +Ia+ ++ gRt  qc +rw+++l
  Bradi1g58087.1.p 522 GRWSEDEDKRLMVSVKLFGSGSWIKIAQFVP-GRTQSQCSERWRNVL 567
                       8******************************.************986 PP

5Myb_DNA-binding35.13e-11574617246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g W +eEd +l+  v+q G   W++Ia  m  +Rt+++c  rw  
  Bradi1g58087.1.p 574 GEWRPEEDSKLLASVHQVGAC-WSKIAGDMIPRRTDNMCLRRWKR 617
                       79*****************99.********99***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.144312410IPR017877Myb-like domain
SMARTSM007170.0013316412IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-10319335IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-10382423IPR009057Homeodomain-like
CDDcd001670.00197385409No hitNo description
SuperFamilySSF466891.48E-5385428IPR009057Homeodomain-like
PROSITE profilePS500908.49411463IPR017877Myb-like domain
SuperFamilySSF466897.95E-21415510IPR009057Homeodomain-like
SMARTSM007177.3E-5415465IPR001005SANT/Myb domain
PfamPF139215.0E-7419467No hitNo description
Gene3DG3DSA:1.10.10.601.3E-12424469IPR009057Homeodomain-like
PROSITE profilePS5129420.069464518IPR017930Myb domain
SMARTSM007171.8E-12468516IPR001005SANT/Myb domain
PfamPF002499.7E-13470513IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-15470514IPR009057Homeodomain-like
CDDcd001675.71E-10472514No hitNo description
Gene3DG3DSA:1.10.10.606.1E-19518569IPR009057Homeodomain-like
PROSITE profilePS5129416.669519571IPR017930Myb domain
SMARTSM007174.7E-11520569IPR001005SANT/Myb domain
SuperFamilySSF466894.58E-24520615IPR009057Homeodomain-like
PfamPF002492.3E-13522567IPR001005SANT/Myb domain
CDDcd001678.52E-11523567No hitNo description
Gene3DG3DSA:1.10.10.602.7E-15570621IPR009057Homeodomain-like
SMARTSM007174.3E-9572621IPR001005SANT/Myb domain
PROSITE profilePS5129411.687573623IPR017930Myb domain
PfamPF002494.3E-9574617IPR001005SANT/Myb domain
CDDcd001671.35E-8575618No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 981 aa     Download sequence    Send to blast
MDLYSDDDSD PEFDEGLQED LDLVRRSCIA AGADPAAASA AAQVSSYLTT PSVPSSAAAL  60
PAAAGDGLSD DDDEDEEEED EDLALVRSIR ENLHLNKASP SSPLPSEPRP ICVWPPSDTD  120
DDDEDDLETL RAIQRRFSHY QAGESTCDPV PSDSNLEAPG TSTGPPENMK NETSKVGGDE  180
FIAHQPGEED VEKQNPKALN RARFPKAALL LVDALKKNRA CQKLIRRKMI NIEAKIEVNK  240
DLRDRVKCLM DYQLGCRRSF GRFLCQKVDP RVRLISSRKP SLQSEKKMSA LLHGPAENLH  300
VSEYKAVLKQ FPISLQKQSW SDMEKDSLAK GVKQQYQEIL IKNSMKNGSS TGDFSALDIA  360
CAMTNTAGNF EVPPEILRSV LPLVNWDKIA AMYLPGRSGA ECESRWLNVD DPLINNNAWT  420
AHEEKTLILT VQEKGMHNWI NIAVALGTQR TPFQCLARYQ RSLNPHILKR VWTKEEDLQL  480
LAAVETFGCN WQLVSASMDG RIGNQCSNRW RKTLLPERTR VGRWSEDEDK RLMVSVKLFG  540
SGSWIKIAQF VPGRTQSQCS ERWRNVLDPD IDHGEWRPEE DSKLLASVHQ VGACWSKIAG  600
DMIPRRTDNM CLRRWKRLCQ DEVPRVIATN QVKKSIFQTN FVDRETERPA IGPSDFPLLV  660
YSKVDRGDGN TVSDQVKKRS RGTCKDNLPA SDPSKSSADV ASVNTTTRKS RKKSSGSGSE  720
MQTGEDIAVS NGVNKSSSGH SRARKRKSNN GNTVVVQKRM RGSISFDNEA SLDILGGPIG  780
IDNEAPRSVG KEGTSEKRTN GFMSAGNEGT LKKKMRGSIS VGDERAAKKK ARGSVPIGNE  840
GNAVKRKRAT RKSAKDSSAA DMADACELDL PTLLSEASVE RDVDTGNVNK MKRKSTPRPR  900
HINIAEGAAD EYSRLADCLS FARRNGTSRN KSCSMRSLNN AMQSNGPSGE NLQGPTVTIS  960
AGPDPIPVEN GSTAKLADND *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-253886403159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-253886403159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1827847KKKARGSVPIGNEGNAVKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228413.10.0PREDICTED: uncharacterized protein LOC100828457 isoform X1
RefseqXP_014752710.10.0PREDICTED: uncharacterized protein LOC100828457 isoform X1
TrEMBLI1H3Y10.0I1H3Y1_BRADI; Uncharacterized protein
STRINGBRADI1G58087.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Representative plantOGRP73551617
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-138myb domain protein 4r1