PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g58057.1.p
Common NameBRADI_1g58057, LOC100827850
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 329aa    MW: 36317.7 Da    PI: 4.9977
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g58057.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.41.5e-49521773128
               NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       pGfrFhPtdeelv++yL++kv+gk+l++ e+ike+diyk+eP+dLpk  +v +++kewyfF+ r +ky+++ r+nr+t +g+Wkatg d++++
  Bradi1g58057.1.p  52 PGFRFHPTDEELVTFYLRRKVAGKRLSI-EIIKEMDIYKHEPSDLPKtsTVGGGDKEWYFFCLRGRKYRNSVRPNRVTGAGFWKATGIDRPIH 143
                       9***************************.89**************95447777999************************************* PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +   vglkk+Lv+y+g+a kg+kt+W+mhe+rl
  Bradi1g58057.1.p 144 G-SAGIVGLKKSLVYYRGSAGKGVKTEWMMHEFRL 177
                       9.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.31150203IPR003441NAC domain
SuperFamilySSF1019411.1E-5451203IPR003441NAC domain
PfamPF023656.1E-2552177IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MVVALKESIM GTMKMMQGDD NHGGSVVLEG GEVVVGEGEV LEEEEEEGVE LPGFRFHPTD  60
EELVTFYLRR KVAGKRLSIE IIKEMDIYKH EPSDLPKTST VGGGDKEWYF FCLRGRKYRN  120
SVRPNRVTGA GFWKATGIDR PIHGSAGIVG LKKSLVYYRG SAGKGVKTEW MMHEFRLPPN  180
TAVNSSPCFQ EAEVWTICRI FKRSVIYKKH PQQQQQHIAA AAPPPQQQQD SSSGVTGCGS  240
LESSDCTGEY AGNYEYTMNN NSMPAPAPAS GGAYYGGGQQ QYFQQGMQWN DGGAMQQPVS  300
DGDVWDDDIG RMVMELTDPS VFYDCTYA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-47422096174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561449.20.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK551e-79NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A0Q3HDM80.0A0A0Q3HDM8_BRADI; Uncharacterized protein
STRINGBRADI1G58057.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP119138129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.13e-76NAC domain containing protein 42