PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g55710.1.p
Common NameBRADI_1g55710, LOC100836677
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family CPP
Protein Properties Length: 788aa    MW: 84802.4 Da    PI: 6.4624
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g55710.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.21.1e-15473511240
               TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       ++k+C+CkkskClk+YCeCfaag++Cse C+C +C Nk 
  Bradi1g55710.1.p 473 SCKRCSCKKSKCLKLYCECFAAGVYCSEPCSCLGCLNKP 511
                       689**********************************96 PP

2TCR50.54e-16558596139
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                       ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+
  Bradi1g55710.1.p 558 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCESCKNT 596
                       589***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.6E-17472513IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.102473598IPR005172CRC domain
PfamPF036381.2E-11475510IPR005172CRC domain
SMARTSM011141.3E-15558599IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11560596IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 788 aa     Download sequence    Send to blast
MDTPDRAALP ASSRAEDSPL FGFIDSMSPI EPLKSAYSTN SLQAYQSLSI TSISSIFTSP  60
HHNTQKESKL SKSSFADFNE SEVCTDHSDK NKPPSSSNAV RLFACTSSIT EETHTATSSV  120
NEGIVDPAKG PNDLPQPGRF ESGSPDHNTT PCHGVRSDLK QDKRRKSEAV QTNKNTLENR  180
KCLFSSNIQL PDGCQPEEGN GEVLGCDWED LVSATSGELL AFDDTSTVED HGGVRLAVNN  240
AESCGFLLSE LNGGCDISDR THPIGTSQVY YHEMVMEEDK TENAQFFSEG QKTMSGEEMQ  300
DNLNEDNACI PLGCKVETHQ QRGTRKRCLV FEAAGYSNRT VQKESVGDLT VSKLKGKSVA  360
QNHTNPGKTP SPRVLRGIGL HLNALALTSK DKIVCQDPLS TALVPSVKTE QDMHGNLLSA  420
GENFVHSSGE LLDLQMDNDD CLAGGFLGND HISSQSSSPQ KKRRKSDNGD DESCKRCSCK  480
KSKCLKLYCE CFAAGVYCSE PCSCLGCLNK PIHEEIVLST RKQIEFRNPL AFAPKVIRLS  540
DAGQETQEDP NNTPASARHK RGCNCKKSSC LKKYCECYQG GVGCSSNCRC ESCKNTFGMR  600
DGAVSVENEE MKQGGEQTES CGKEKENDEQ KANVHNGDHQ LVELGVPITP PLAISSSLLQ  660
QPNFSNAKPP RPSKPRTGSS SRPSKAAASV LSHKIPKVAN SVFNEEVPDI LTEPASPGIV  720
KTSSPNGKRV SPPHNSLSIS PSRRGGRKLI LKSIPSFPSL LGDTSSGSAI SNSNSAFTES  780
SLALGPP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-1647559512120Protein lin-54 homolog
5fd3_B6e-1647559512120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1158164LKQDKRR
2460464KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g55710.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557490.10.0protein tesmin/TSO1-like CXC 2
TrEMBLI1H3640.0I1H364_BRADI; Uncharacterized protein
STRINGBRADI1G55710.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Representative plantOGRP9931755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.13e-81TESMIN/TSO1-like CXC 2