PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g51270.1.p
Common NameBRADI_1g51270, LOC100829933
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 262aa    MW: 27421.1 Da    PI: 8.5792
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g51270.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.56.2e-2085139256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Lee+F+ +++++ +++  LA++lgL  rqV vWFqNrRa+ k
  Bradi1g51270.1.p  85 RKKLRLSKDQAAILEECFKTHHTLTPKQKLALANSLGLRPRQVEVWFQNRRARTK 139
                       678899***********************************************98 PP

2HD-ZIP_I/II122.42.2e-3985173189
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                       +kk+rlsk+q+++LEe+F+++++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e++kr++++l+++n+rLeke ++Lr+
  Bradi1g51270.1.p  85 RKKLRLSKDQAAILEECFKTHHTLTPKQKLALANSLGLRPRQVEVWFQNRRARTKLKQTEVDCEHMKRWCEQLVDQNRRLEKELADLRA 173
                       69************************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.37E-1873142IPR009057Homeodomain-like
PROSITE profilePS5007116.5281141IPR001356Homeobox domain
SMARTSM003894.9E-1783145IPR001356Homeobox domain
PfamPF000463.5E-1785139IPR001356Homeobox domain
CDDcd000861.49E-1585142No hitNo description
Gene3DG3DSA:1.10.10.601.0E-1890139IPR009057Homeodomain-like
PRINTSPR000313.4E-5112121IPR000047Helix-turn-helix motif
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
PRINTSPR000313.4E-5121137IPR000047Helix-turn-helix motif
SMARTSM003401.6E-14141184IPR003106Leucine zipper, homeobox-associated
PfamPF021835.2E-8141173IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MAPQSLDLGL SLGLGFVSSR SGGFVPYSGD APADREQEVA MPEEERTTTC SPGSPASSGG  60
SGTKRSAGSG DEDDVDADGG GINGRKKLRL SKDQAAILEE CFKTHHTLTP KQKLALANSL  120
GLRPRQVEVW FQNRRARTKL KQTEVDCEHM KRWCEQLVDQ NRRLEKELAD LRAAAPAPAP  180
PLMTTLTMCL SCKSVASSSS SSPACAPNAG IGMGMGIGMP GPAAPLTGQR QFWCGYRETA  240
GAAAAAYGVS SGLAKAVKPA R*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g51270.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557217.10.0homeobox-leucine zipper protein HOX28
SwissprotA2Y9316e-63HOX28_ORYSI; Homeobox-leucine zipper protein HOX28
SwissprotQ5VPE56e-63HOX28_ORYSJ; Homeobox-leucine zipper protein HOX28
TrEMBLI1H1Q40.0I1H1Q4_BRADI; Uncharacterized protein
STRINGBRADI1G51270.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-41homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]