PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g51257.3.p
Common NameLOC100829626
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 313aa    MW: 32628.4 Da    PI: 9.9907
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g51257.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-19137191256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++k+q  +Lee+F+ +++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  Bradi1g51257.3.p 137 RKKLRLSKDQAAVLEECFKTHSTLNPKQKTALANRLGLRARQVEVWFQNRRARTK 191
                       678899***********************************************98 PP

2HD-ZIP_I/II120.77.5e-39137227192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       +kk+rlsk+q+++LEe+F+++++L+p++K++la++Lgl++rqv+vWFqnrRARtk+kq+E+d+e++kr++++l+++n+rLekev+eLr +lk
  Bradi1g51257.3.p 137 RKKLRLSKDQAAVLEECFKTHSTLNPKQKTALANRLGLRARQVEVWFQNRRARTKLKQTEVDCEYMKRWCEQLADQNKRLEKEVAELR-ALK 227
                       69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-17125187IPR009057Homeodomain-like
PROSITE profilePS5007116.39133193IPR001356Homeobox domain
SMARTSM003897.2E-16135197IPR001356Homeobox domain
SuperFamilySSF466891.2E-17135202IPR009057Homeodomain-like
PfamPF000469.3E-17137191IPR001356Homeobox domain
CDDcd000864.62E-13137194No hitNo description
PRINTSPR000314.8E-5164173IPR000047Helix-turn-helix motif
PROSITE patternPS000270168191IPR017970Homeobox, conserved site
PRINTSPR000314.8E-5173189IPR000047Helix-turn-helix motif
PfamPF021831.5E-9193227IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.4E-19193236IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MMSRGGGGGG SLDLGLGLGL GLASQGSLTS STTTASSSPA SQQQHWHAAL SSVVSADAGA  60
AVAARMEFPS SYQQQHYGQQ QEGRTSTSPE SGAALSGVSG GGGGGGIKRG LERTGSGVSR  120
GAAISDEDED GGGGGGRKKL RLSKDQAAVL EECFKTHSTL NPKQKTALAN RLGLRARQVE  180
VWFQNRRART KLKQTEVDCE YMKRWCEQLA DQNKRLEKEV AELRALKAAS APAAQQQSAA  240
TLTMCPSCRR VATTGTPLQQ QCHPKSNTAH AAAAGNVLPS HCQFFPSAGD RSARQATWNG  300
APPPPLVTRE LF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185193RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g51257.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0599891e-147EF059989.1 Brachypodium sylvaticum hypothetical protein (57h21.1), methyl sulfoxide reductase (57h21.2), hypothetical protein (57h21.3), oxidoreductase (57h21.4), auxin efflux carrier (57h21.6), CCR4 associated factor-like protein (57h21.7), ribosomal subunit 8E protein (57h21.8), expressed protein (57h21.9), expressed protein (57h21.10), acid phosphatase (57h21.11), polygalacturonase inhibitor (57h21.12), proteasome (57h21.13), leucine carboxyl methyl transferase (57h21.14), homeobox (57h21.15), serine threonine kinase (57h21.16), hypothetical protein (57h21.17), GTP binding protein (57h21.18), zinc carboxy peptidase (57h21.20), DNA repair protein (57h21.21), coatomer complex subunit (57h21.22), sulfate transporter (57h21.23), hypothetical protein (57h21.24), hypothetical protein (57h21.25), hypothetical protein (57h21.26), acyl-ATP thioesterase (57h21.27), hypothetical protein (57h21.28), hypothetical protein (57h21.29), superoxide dismutase (57h21.30), expressed protein (57h21.31), protein kinase (57h21.32), early nodulin protein (57h21.33), early nodulin protein (57h21.34), hypothetical protein (57h21.36), hypothetical protein (57h21.37), and expressed protein (57h21.38) genes, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557216.10.0homeobox-leucine zipper protein HOX2
SwissprotQ5VPE32e-82HOX2_ORYSJ; Homeobox-leucine zipper protein HOX2
SwissprotQ84U862e-82HOX2_ORYSI; Homeobox-leucine zipper protein HOX2
TrEMBLI1H1Q30.0I1H1Q3_BRADI; Uncharacterized protein
STRINGBRADI1G51257.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.18e-52homeobox-leucine zipper protein 4
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]