PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g51040.1.p
Common NameBRADI_1g51040, LOC100824321
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Whirly
Protein Properties Length: 275aa    MW: 30381.7 Da    PI: 9.2032
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g51040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly194.61.5e-60992371139
            Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrka 93 
                       s+yk+kaal+ +++ p+f+ ldsg+ k+ ++G++ll++a+a+a r+ydW +kq+f+ls+ e+++l+ l++ +sceffhdp+++ s+eGkvrk+
  Bradi1g51040.1.p  99 SIYKGKAALSFDPRPPQFVPLDSGAYKVAKEGFVLLQFAPAVAARQYDWTRKQVFSLSVWEMGTLLTLGPTDSCEFFHDPFKGRSDEGKVRKV 191
                       7******************************************************************************************** PP

            Whirly  94 lkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                       lkveP pdG G f+nlsv+n l++ +es+++P++k+e+av+ s ++
  Bradi1g51040.1.p 192 LKVEPTPDGNGRFFNLSVQNRLLNIDESVYIPITKGEYAVIVSTFN 237
                       *****************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.106.4E-7987259IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.73E-7491274IPR009044ssDNA-binding transcriptional regulator
PfamPF085366.4E-58100234IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MPPPLSLSLP SPPPPLLQPH SLLPHQAKAF HSLTLAPARM PSVPASFACS VVPARHSDYF  60
DPRARAPPPP PRDEYGEPPP PPLAPGQGGQ SGRVYASYSI YKGKAALSFD PRPPQFVPLD  120
SGAYKVAKEG FVLLQFAPAV AARQYDWTRK QVFSLSVWEM GTLLTLGPTD SCEFFHDPFK  180
GRSDEGKVRK VLKVEPTPDG NGRFFNLSVQ NRLLNIDESV YIPITKGEYA VIVSTFNYII  240
PHIMGWSTFT NSIKLEDSQP YSRPQSSPEL EWRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4koq_A3e-91932548169Single-stranded DNA-binding protein WHY3, chl
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3654520.0AK365452.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2034E15.
GenBankAK3537950.0AK353795.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1002M22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557198.10.0PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like
SwissprotB2LXS71e-137WHY1_MAIZE; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLI1H1M70.0I1H1M7_BRADI; Uncharacterized protein
STRINGBRADI1G51040.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP23161635
MonocotsOGMP30123885
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.21e-94ssDNA-binding transcriptional regulator