PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g47900.2.p
Common NameBRADI_1g47900, LOC100836102
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 471aa    MW: 51260.3 Da    PI: 6.7542
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g47900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS357.81.6e-109654431373
              GRAS   1 lvelLlecAeavssgdlelaqalLarlsel...aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                       lv+ L++cA a+++gd   a + La+ ++l     p+ + + R++++f+ ALa rl++ +++  +++pps++s++   ++   ++ f+++ P 
  Bradi1g47900.2.p  65 LVHILVTCAAAIQAGDYGVAVNNLAEAHTLlatTIPTSSGIGRVTSHFATALAYRLFSASPH--SSMPPSSSSPSPNNQAGEQYRQFYDMVPH 155
                       689***********************99997545577799******************5555..5688888888889999999********** PP

              GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                       lkf+h++aNqaIlea++g+++vHiiD+ i+ GlQW++L+qa++ +++gpps+RiTgvg+  +g ++ ++e+g  L++ A+ l+vpf+f+ +++
  Bradi1g47900.2.p 156 LKFAHFAANQAILEAFQGHDQVHIIDLAIMRGLQWLPLIQAFSLQSGGPPSIRITGVGPTPTGPHDDIQEVGLLLTEHARVLNVPFSFHSVTC 248
                       ***********************************************************8888****************************** PP

              GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsles....erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                       ++le l+++++++ + Ea+a+n+++qlhrll ++ + +     ++d+vL  +  ++Pkv+++veqeadhn+++++erf++al yy + fds+e
  Bradi1g47900.2.p 249 DSLEGLKPWMFHLIHSEAVAINSIFQLHRLLGDPDAASTslppPIDTVLGWITAMRPKVFTIVEQEADHNKPELVERFTNALFYYGVAFDSME 341
                       *******************************6654443334449************************************************* PP

              GRAS 273 aklpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                       a +pr +  ++    ++ l+rei ++v++eg+ r+erhetl+ Wr rl++aG+ +vpl+ ++   a++llr +++ gy+v e+ + l+l W++
  Bradi1g47900.2.p 342 AIVPRSQaGTAGLAAEAHLQREIFDIVCNEGSGRVERHETLQCWRGRLRRAGLAQVPLGPNNLRHASMLLRIFSGAGYHVMERGDGLMLAWHG 434
                       *****9986666666666*************************************************************************** PP

              GRAS 365 rpLvsvSaW 373
                       +pL+svS+W
  Bradi1g47900.2.p 435 NPLFSVSVW 443
                       ********* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.68839424IPR005202Transcription factor GRAS
PfamPF035145.5E-10765443IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MRNFLLGWPS MGPANSSLLT GTVPSPSTQA VATTNTNNRV DPPSTHASHH LHPAMSLHEH  60
AAIRLVHILV TCAAAIQAGD YGVAVNNLAE AHTLLATTIP TSSGIGRVTS HFATALAYRL  120
FSASPHSSMP PSSSSPSPNN QAGEQYRQFY DMVPHLKFAH FAANQAILEA FQGHDQVHII  180
DLAIMRGLQW LPLIQAFSLQ SGGPPSIRIT GVGPTPTGPH DDIQEVGLLL TEHARVLNVP  240
FSFHSVTCDS LEGLKPWMFH LIHSEAVAIN SIFQLHRLLG DPDAASTSLP PPIDTVLGWI  300
TAMRPKVFTI VEQEADHNKP ELVERFTNAL FYYGVAFDSM EAIVPRSQAG TAGLAAEAHL  360
QREIFDIVCN EGSGRVERHE TLQCWRGRLR RAGLAQVPLG PNNLRHASML LRIFSGAGYH  420
VMERGDGLML AWHGNPLFSV SVWHVMEEEL EDNKNNVVRH VTTGAMLSMQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-40654444375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561023.10.0PREDICTED: DELLA protein GAI-like
TrEMBLA0A0Q3L8980.0A0A0Q3L898_BRADI; Uncharacterized protein
STRINGBRADI1G47900.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.18e-91GRAS family protein