PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g46675.1.p
Common NameBRADI_1g46675
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 163aa    MW: 18893.1 Da    PI: 10.0236
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g46675.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.91.1e-121152344
                      --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
            SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                      i n+ +r  t  kR+ g+ KK +EL +LCd+ ++++++ ++ 
  Bradi1g46675.1.p 11 IVNNAKRRATMKKRLPGLVKKISELAILCDIPACLVVYRPDE 52
                      779999*******************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.241148IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-9160IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-7323IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-20494IPR002100Transcription factor, MADS-box
CDDcd002662.90E-19585No hitNo description
PfamPF003191.1E-121152IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MPHGRVKLQW IVNNAKRRAT MKKRLPGLVK KISELAILCD IPACLVVYRP DEEQPAVWPS  60
TRETTNVVQK YYDLPESKKL KKMLDVEGFQ QQQVDKEKAE LFNAHRDNCD QEINLIMKQF  120
IAHRRHSFED LTTEVLIHLK LKVKESLKAI DTRLQKIHLG GI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g46675.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693511e-133KF469351.1 Brachypodium distachyon MADS-box transcription factor 57 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024312442.11e-118agamous-like MADS-box protein AGL80
TrEMBLA0A0Q3K3Y71e-116A0A0Q3K3Y7_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.23e-24M-type_MADS family protein