PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g43990.1.p
Common NameBRADI_1g43990, LOC100840783
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family CO-like
Protein Properties Length: 437aa    MW: 47709.9 Da    PI: 5.7859
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g43990.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.23.3e-081861340
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                      +r C+ + + +++++C  ++ +lC+ C  + H+       H++v
  Bradi1g43990.1.p 18 ARACDGCLRRRARWYCAADDAFLCQACDASVHSAnplarrHERV 61
                      578*****************************657888888876 PP

2CCT66.85.9e-23382425144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       R+a+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  Bradi1g43990.1.p 382 RDARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 425
                       99****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.0E-121663IPR000315B-box-type zinc finger
PROSITE profilePS5011910.7221663IPR000315B-box-type zinc finger
PfamPF006431.0E-61961IPR000315B-box-type zinc finger
CDDcd000211.49E-101963No hitNo description
PfamPF062031.1E-17382424IPR010402CCT domain
PROSITE profilePS5101715.934382424IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MSSSLAKAAA GAMGSKAARA CDGCLRRRAR WYCAADDAFL CQACDASVHS ANPLARRHER  60
VRLRPTSPLQ AGAGGPRARR GDEVVPAWFK RKPRTPRGKS VIGHLLSSRR PVVVPDEASG  120
GEGSPEEHKL FEGETDEEEL LYSVPVFDPA LAELCSPSSP RHLEDYASCC NEDRVVVLES  180
PTEPAAPSLA VDQFFPDSVV SFGPTDAELM EFAADMEALL GRGLDEGTEE EPFCMEALGL  240
IQPMVDVDGA GGRVKMETDG EARGMFLACG LEREPETEVS GNMLGIDFDD DYGSPQATPD  300
ENAASGSAAR FLPRSLSLNL NYEAIIDKWE KSPWADGKRP DVKLDGCWPH DYSMSVWMMG  360
GVLVGHGTEE LRTPRTKMDG GRDARVSRYR EKRRTRLFSK KIRYEVRKLN AEKRPRMKGR  420
FVKRANGVAV ATACVA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1392408RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3703041e-104AK370304.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2108I12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560836.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLI1GZ670.0I1GZ67_BRADI; Uncharacterized protein
STRINGBRADI1G43990.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8021649
MonocotsOGMP32833058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.13e-71B-box type zinc finger protein with CCT domain