PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g43710.1.p
Common NameBRADI_1g43710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 479aa    MW: 51027.5 Da    PI: 5.8436
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g43710.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.61.2e-27189243156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k++++WtpeLH+rFv+aveqL G++kA+P++ile+m++++Lt+++++SHLQkYR++
  Bradi1g43710.1.p 189 KAKVDWTPELHRRFVQAVEQL-GIDKAVPSRILEIMGIDSLTRHNIASHLQKYRSH 243
                       6799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.924186245IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-27187246IPR009057Homeodomain-like
SuperFamilySSF466897.17E-19187246IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-26189243IPR006447Myb domain, plants
PfamPF002496.7E-8192241IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MLAVSTPRCG ADAEDQRAVE LETAGAHFDM DQLDFTVDDI DFGDFFLRLE HGDALPDLEV  60
DDDPAADIFS DFEAAVATGG AVEELQDQEV PCDELLPGSL LHDDVGSVSP TGGGVIGAVE  120
NMAFAEAADD GEKEGCNQAM EDGNVNCNVG GNGAAMEDAK SPCSTASSSQ EAESRHKSSR  180
KKNSHGKKKA KVDWTPELHR RFVQAVEQLG IDKAVPSRIL EIMGIDSLTR HNIASHLQKY  240
RSHRKHMLAR EAEAASWTQR RHAYAAGGPA GAAKKQETSM WTVPTIGFSP SPAPLPPPPP  300
PPHPAMQHFA RPLHVWGHPS TDPHSPRVAV WPPRHPATPR GPVPPPPPSW AAPPPTFWHH  360
PYMRGPAHAY MPATHGTPCV AMPMAPAKFP APPVAGVMPC PVYTPLSAPA SKKQQDSQLQ  420
LQAQPSNESI DAAIGDVLTK PWLPLPLGLK PPSLGSVMGE LQRQGVSNVP QACGLFGV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-16186241257ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional activator that promotes chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. {ECO:0000269|PubMed:19808806}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g43710.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. {ECO:0000269|PubMed:11340194}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024313158.10.0probable transcription factor GLK1 isoform X2
SwissprotQ5Z5I41e-154GLK1_ORYSJ; Probable transcription factor GLK1
TrEMBLI1GZ330.0I1GZ33_BRADI; Uncharacterized protein
STRINGBRADI1G43710.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24153886
Representative plantOGRP28401529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.14e-43GOLDEN2-like 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang Y, et al.
    A highly efficient rice green tissue protoplast system for transient gene expression and studying light/chloroplast-related processes.
    Plant Methods, 2011. 7(1): p. 30
    [PMID:21961694]