PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g41712.2.p
Common NameBRADI_1g41712, LOC100821586
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 347aa    MW: 37188.8 Da    PI: 8.0291
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g41712.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.95.7e-55141421128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+++yL++kv++ +++ +++i+e+d++k+ePw+Lp k+k +ekewyf+s rd+ky+tg r+nrat +gyWkatgkd+e+ 
  Bradi1g41712.2.p  14 LPPGFRFHPTDEELISYYLARKVADVNFSGARAIAEIDLNKCEPWELPDKAKMGEKEWYFYSLRDRKYPTGLRTNRATGAGYWKATGKDREIR 106
                       79****************************999***************99999**************************************** PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s+ +g+lvg+kktLvfy+grapkg kt+Wvmhe+rl
  Bradi1g41712.2.p 107 SArTGALVGMKKTLVFYRGRAPKGAKTQWVMHEFRL 142
                       9868889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-6010169IPR003441NAC domain
PROSITE profilePS5100558.73814169IPR003441NAC domain
PfamPF023652.8E-2715142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048366Biological Processleaf development
GO:0048467Biological Processgynoecium development
GO:0048504Biological Processregulation of timing of organ formation
GO:0051782Biological Processnegative regulation of cell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MERYGLLGTR EEELPPGFRF HPTDEELISY YLARKVADVN FSGARAIAEI DLNKCEPWEL  60
PDKAKMGEKE WYFYSLRDRK YPTGLRTNRA TGAGYWKATG KDREIRSART GALVGMKKTL  120
VFYRGRAPKG AKTQWVMHEF RLDGNCAYHF FSNNNATRDE WVIAKIFVKP GALPAARNKL  180
ARFGLQGSTG GADTSCFSDS TTSVSIGCGG GGGDTTTNTS SLFAAAADGE SSSCGGGNNN  240
NCGRELVPCF STGAHMDATL LGIGQYDPAP LAMEQPPALY QLSAARSVQD NLLFLSGGGL  300
QSGLVSPLGV GGGAFQYWPT SSGYDMKPPQ MAVGPGQLDG SFGWGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-531416917165NO APICAL MERISTEM PROTEIN
1ut4_B2e-531416917165NO APICAL MERISTEM PROTEIN
1ut7_A2e-531416917165NO APICAL MERISTEM PROTEIN
1ut7_B2e-531416917165NO APICAL MERISTEM PROTEIN
4dul_A2e-531416917165NAC domain-containing protein 19
4dul_B2e-531416917165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00562DAPTransfer from AT5G53950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126141e-132CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
GenBankAP0149621e-132AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0046791e-132AP004679.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0021N09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563845.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotQ9FRV43e-83NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBLA0A0Q3H6Y00.0A0A0Q3H6Y0_BRADI; Uncharacterized protein
STRINGMLOC_65286.11e-154(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99403543
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15170.16e-84NAC family protein