PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g39180.2.p
Common NameBRADI_1g39180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 528aa    MW: 57668.9 Da    PI: 8.86
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g39180.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like971.4e-30105158255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       prlrWtp+LH +F++ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  Bradi1g39180.2.p 105 PRLRWTPDLHMAFLRAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 158
                       8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-28101159IPR009057Homeodomain-like
PROSITE profilePS5129412.496101161IPR017930Myb domain
SuperFamilySSF466892.51E-14103159IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-22105160IPR006447Myb domain, plants
PfamPF002498.8E-9106157IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MGEVKEKQEV VEILEDDGKG TGTWDNAVPL ATLDLNEDFS EAGNMYYNDA DDDDNGGGGS  60
TSEVAGGRNS SNNSSTNNDS DSRKGDMDGC EKVPTVRQYN RSKHPRLRWT PDLHMAFLRA  120
VERLGGQERA TPKLVLQMMN VRGLSIAHVK SHLQMYRSKK IEHQSSHERA AISSVFPPMN  180
FHMRRADHRF HDMFFQRAAG SSLSSRLNEN SGILASRNAD LPDTRQIYGL LQRRKPPSAI  240
HTFDSNNYSS LRNQEWAFTQ RVAAARTAAV NDHVPAKGLV HEMTFRKDRK PTPDKFNARD  300
ANAANRTSPL ASMSGAADRR PEDGAKVGSI NGIGSSPRPT SRTMSAARLT TTGFELSPSL  360
WPRAAGSNGC DHPSRNISTT SSSDLVGATR ESGSLPLLQK QEQREPTAPS KNIEVKETRF  420
ETDAWRKKTL ASEASGWTPE LQLSLSPNVE ADNNGRGKKR SSAELEVGNH NNNLPLSLSL  480
SLRDCVAVDD GGCGDARRLE VATDSRSKKA ALGLSTLDLT MSIKALE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A8e-18106160357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-18106160357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-18106160357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-18106160357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g39180.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0736061e-101AK073606.1 Oryza sativa Japonica Group cDNA clone:J033048N17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024316695.10.0uncharacterized protein LOC100830272
TrEMBLA0A0Q3H6I60.0A0A0Q3H6I6_BRADI; Uncharacterized protein
STRINGBRADI1G39180.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-33G2-like family protein