PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g36236.2.p
Common NameBRADI_1g36236, LOC100832625
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 334aa    MW: 36662.9 Da    PI: 6.2893
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g36236.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97.4e-3152106155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       ++rlrWt eLH rF++a++qLGG+++AtPk il++m+v+gLt+ hvkSHLQkYRl
  Bradi1g36236.2.p  52 RQRLRWTDELHGRFLDALTQLGGPDRATPKGILRTMGVQGLTICHVKSHLQKYRL 106
                       58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.82249109IPR017930Myb domain
SuperFamilySSF466891.11E-1751107IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-2951107IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-2553107IPR006447Myb domain, plants
PfamPF002491.1E-554105IPR001005SANT/Myb domain
PfamPF143796.6E-21138184IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MRGCQMYEPK PLSSTGSAHN NPIPHNQQIV PTANNAASNI GGNSSNINFA TRQRLRWTDE  60
LHGRFLDALT QLGGPDRATP KGILRTMGVQ GLTICHVKSH LQKYRLSKYI PDPTADGAKS  120
DKKELGNLLA GIESSPGMEL SEALKLQMEV QKRLRDQLEV QRQLQLRIEA QGKYLQKIME  180
EQQRLTGVLC ESGTLNALVP VQELRQDFNK TDPLTPVPTS EPLIRDKAST VSDDHEGTDG  240
LLKDLSSHDE CHSSGREPLT PDSSCGAASP LDIPRDRLDH QNSESVLHHN ILESRSGSDF  300
QQASSVFPSS TRRSDSPAAL YVSEDDFKNS PDV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-2052109259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-2052109259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-2052109158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-2052109158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-2052109158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-2052109158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-2052109259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-2052109259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-2052109259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-2052109259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-2052109259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-2052109259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g36236.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024312887.10.0myb family transcription factor PHL7 isoform X1
SwissprotQ9SJW06e-87PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A0Q3L3I90.0A0A0Q3L3I9_BRADI; Uncharacterized protein
STRINGBRADI1G36236.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22203896
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-87G2-like family protein