PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g34470.6.p
Common NameBRADI_1g34470, LOC100823547
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 474aa    MW: 51652.4 Da    PI: 6.2671
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g34470.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.64.2e-31266320155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k rlrWt eLHe+Fveav++L G+ekAtPk +l+lmkv+gLt++hvkSHLQkYR 
  Bradi1g34470.6.p 266 KSRLRWTLELHESFVEAVNKLEGPEKATPKGVLKLMKVEGLTIYHVKSHLQKYRH 320
                       68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.3E-16263320IPR009057Homeodomain-like
PROSITE profilePS5129410.799263323IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-29264321IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-23266320IPR006447Myb domain, plants
PfamPF002491.2E-7268319IPR001005SANT/Myb domain
PfamPF143791.6E-21358403IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MSSQAVVAVK PTTAPDKTVH SYACGSTQSS VHKLPDAKLD HLRFLDDNLS STSQSSNIKT  60
ELIRSSSLPF RLQKRSPLSD PESPLSHVSQ PNFSDPMASN SSTFCTSLFS SSSTNSAPCQ  120
QKGALPFLPP PPKCEQQVIP GQSCSSSLHL TGDIGNAYDE AEHSDDMKDF LNLSGDASDA  180
SYHGEDNAMA FTEQMEFQFL SEQLGIAITD NEESPRLDDI YDTPPPQLSS LPVSSCSNQS  240
LHNLGSPVKL PLCSARSSSG STTTNKSRLR WTLELHESFV EAVNKLEGPE KATPKGVLKL  300
MKVEGLTIYH VKSHLQKYRH ARYLPDMKED KKASLDCKKV QSAQSGSNGS YLDKNKNLAE  360
ALRMQMEVQK QLHEQLEVQR QLQLRIEEHA KYLHRILEEQ QKASNGGSSS LKISTEPTES  420
TSINGTAPEE ATTSSPHPSK NIAAPEAGTE CDSPVRNKRA KVHGDLESES PCS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-27266323259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-27266323259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-27266323259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-27266323259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-27266323259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-27266323259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-27266323259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-27266323259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling (PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:26082401). Functionally redundant with PHR1 and PHR2 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). {ECO:0000269|PubMed:26082401}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g34470.6.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated under Pi starvation conditions. {ECO:0000269|PubMed:26082401}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563523.10.0protein PHOSPHATE STARVATION RESPONSE 3
RefseqXP_024313685.10.0protein PHOSPHATE STARVATION RESPONSE 3
SwissprotQ6YXZ41e-154PHR3_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 3
TrEMBLI1GWS30.0I1GWS3_BRADI; Uncharacterized protein
STRINGBRADI1G34470.40.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-71G2-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]