PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g33870.2.p
Common NameBRADI_1g33870, LOC104581494
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 205aa    MW: 22356.1 Da    PI: 8.5988
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g33870.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.8e-1991145256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ ++tkeq + Le+ F+ +  +s+ +++eLA++l+L+ rqV vWFqNrRa+ k
  Bradi1g33870.2.p  91 RKKLRLTKEQCTLLEDSFHAHVILSQVQKQELARRLNLSPRQVEVWFQNRRARTK 145
                       788899***********************************************98 PP

2HD-ZIP_I/II114.18.6e-3791178188
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                       +kk+rl+keq +lLE+sF+++  L++ +K+elar+L+l+prqv+vWFqnrRARtk+kq+E+++e+Lkr++++l++en+rL++e  +L+
  Bradi1g33870.2.p  91 RKKLRLTKEQCTLLEDSFHAHVILSQVQKQELARRLNLSPRQVEVWFQNRRARTKLKQTEVECEFLKRCCESLTDENQRLKHELLDLQ 178
                       69*********************************************************************************99998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-2066148IPR009057Homeodomain-like
SuperFamilySSF466896.68E-2071148IPR009057Homeodomain-like
PROSITE profilePS5007117.50887147IPR001356Homeobox domain
SMARTSM003895.7E-1689151IPR001356Homeobox domain
PfamPF000462.3E-1691145IPR001356Homeobox domain
CDDcd000864.97E-1591148No hitNo description
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PfamPF021834.9E-8147178IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.4E-15147190IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MEQEDFSSWL GLATGGSGGA VRRSQDGAER RRAKEETACE RQQLAAIGES GGEGATKQRI  60
SVRGGGRSPS NGPCPSDGGS DDVAGGSTGT RKKLRLTKEQ CTLLEDSFHA HVILSQVQKQ  120
ELARRLNLSP RQVEVWFQNR RARTKLKQTE VECEFLKRCC ESLTDENQRL KHELLDLQRS  180
AGPRAAAAAM LNFCPACEKV TLNN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18995TRKKLRL
2139147RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g33870.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010227405.11e-147homeobox-leucine zipper protein HOX18
SwissprotQ5Z6F65e-48HOX18_ORYSJ; Homeobox-leucine zipper protein HOX18
TrEMBLA0A0Q3RX661e-146A0A0Q3RX66_BRADI; Uncharacterized protein
STRINGBRADI1G33870.11e-139(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81303448
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-42HD-ZIP family protein