PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g32370.1.p
Common NameBRADI_1g32370, LOC100845348
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 244aa    MW: 27340.2 Da    PI: 9.2739
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g32370.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.22.4e-301871255
           G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      pr+rWt+eLH++F+eave LGG+++AtPk+il+lm+vkg++++h+kSHLQ+YR+
  Bradi1g32370.1.p 18 PRMRWTEELHRQFIEAVECLGGQDEATPKRILHLMGVKGISISHIKSHLQMYRS 71
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.9671474IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-281473IPR009057Homeodomain-like
SuperFamilySSF466891.08E-161672IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-251871IPR006447Myb domain, plants
PfamPF002492.0E-91970IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MRGFERRGVR QYNRSDEPRM RWTEELHRQF IEAVECLGGQ DEATPKRILH LMGVKGISIS  60
HIKSHLQMYR SSSSNNSNSN SPANAFANRR QDHRHADDAY SRDWNKTAAT SDDKNRSTTP  120
YTFLRRGHQH SSPCRIPSIE EVFRNWEQSR GRVPCSSGVL ITTTEKAMGW PVRHAESKKR  180
QNQIMAAAGC DLTLSIGRWE EASSSDADGS STTTTEEAAV PPRGRPAGPD LNLDLTISSS  240
WLT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-161972356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-161972356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-161972356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-161972356Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g32370.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4067633e-67CU406763.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C005B16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560440.10.0myb family transcription factor PHL11
TrEMBLI1GW230.0I1GW23_BRADI; Uncharacterized protein
STRINGBRADI1G32370.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54933758
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04580.12e-24G2-like family protein