PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g32070.2.p
Common NameBRADI_1g32070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 469aa    MW: 51418.4 Da    PI: 7.8735
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g32070.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3642.2e-111584361373
              GRAS   1 lvelLlecAeavssgdlelaqalLarlsel...aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                       lv+ L++cA a+++gd  +a ++L + +++     p+ + + R++ +f+ ALa+rl++   +  ++l+ps++s++   ++   ++ f++  P 
  Bradi1g32070.2.p  58 LVHMLVTCAAAIQAGDYGAAATYLIEARTIlvnTIPTSSGIGRVTIHFATALAHRLNS--ASPNSSLSPSSSSPSANNHASEQYRQFYDQVPH 148
                       689*********************9999987656677899******************..55556688888888888888889999******* PP

              GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                       lkf+h+taNqa lea+ g++rvHiiD+ i+ GlQW++L++a++  p+gpps+RiTgvg+ ++gs++el+e+g  L++ A+ l+vpf+f++++ 
  Bradi1g32070.2.p 149 LKFAHFTANQAFLEAFRGHDRVHIIDLAIMCGLQWLSLIKAFSIWPGGPPSIRITGVGPTHTGSRDELREVGLMLTEHARVLNVPFSFHIVTG 241
                       ***********************************************************9999****************************** PP

              GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrll....desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                       ++le l+++++++ +gEa+aVn++ qlhrll    + s+sl+ ++d+vL  + s++Pkv++vveqeadhn+++++erf++al yy a+fds+e
  Bradi1g32070.2.p 242 DNLEGLKPWMFHLVQGEAIAVNSICQLHRLLvdpdAASTSLPPPIDTVLGWITSMRPKVFTVVEQEADHNKPTLVERFTNALFYYGAMFDSME 334
                       ******************************94444445555559************************************************9 PP

              GRAS 273 aklpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                       a + r    ++    ++ l+rei n+v++eg++r+erhetl +Wr+rl++aG+ +vpl+ ++   a++ll+  ++dgy+v e+ + l+l W++
  Bradi1g32070.2.p 335 AVATRSRtGAAERGAEVHLKREIFNIVCNEGSSRVERHETLPRWRARLRRAGLAQVPLRPNNLRHASMLLHDLSGDGYHVMERGDGLMLAWHN 427
                       887766666666666677*************************************************************************** PP

              GRAS 365 rpLvsvSaW 373
                       +pL+svS+W
  Bradi1g32070.2.p 428 NPLFSVSVW 436
                       ********* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.84532417IPR005202Transcription factor GRAS
PfamPF035147.5E-10958436IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
PSTGPAASSP LIETVPPPST QAAATTNTNT NNRVNPSTYT SHSLQPAMSL HERAAIRLVH  60
MLVTCAAAIQ AGDYGAAATY LIEARTILVN TIPTSSGIGR VTIHFATALA HRLNSASPNS  120
SLSPSSSSPS ANNHASEQYR QFYDQVPHLK FAHFTANQAF LEAFRGHDRV HIIDLAIMCG  180
LQWLSLIKAF SIWPGGPPSI RITGVGPTHT GSRDELREVG LMLTEHARVL NVPFSFHIVT  240
GDNLEGLKPW MFHLVQGEAI AVNSICQLHR LLVDPDAAST SLPPPIDTVL GWITSMRPKV  300
FTVVEQEADH NKPTLVERFT NALFYYGAMF DSMEAVATRS RTGAAERGAE VHLKREIFNI  360
VCNEGSSRVE RHETLPRWRA RLRRAGLAQV PLRPNNLRHA SMLLHDLSGD GYHVMERGDG  420
LMLAWHNNPL FSVSVWHIME EELEDNKNKV VRRSSTHLAT AGAMLSMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-43584374375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229736.10.0PREDICTED: DELLA protein GAI1-like
TrEMBLA0A0Q3NHV10.0A0A0Q3NHV1_BRADI; Uncharacterized protein (Fragment)
STRINGBRADI1G32070.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.14e-76GRAS family protein