PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g30140.1.p
Common NameBRADI_1g30140, LOC100823660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 270aa    MW: 28701.3 Da    PI: 6.7177
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g30140.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.81.1e-0895140752
                       HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                        rr   NR A r++R++Kka ++ Lee+v  L+a Nk+L k++++ 
  Bradi1g30140.1.p  95 KRRPSGNRAAVRKYREKKKAHTALLEEEVVHLKALNKELMKKVQNH 140
                       577778**********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.7E-1089156IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.44E-792140No hitNo description
PfamPF077166.1E-1393144IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.8E-1393157No hitNo description
CDDcd146863.48E-1294148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MDDGDLDFNP DTYLCSGAAA GGTETPGACS MDSYFDEILK DTEHLACTHT HTCNPPVHDL  60
SHTHTCVHVH TKIVSASSDG AESPAENTTS GTSKKRRPSG NRAAVRKYRE KKKAHTALLE  120
EEVVHLKALN KELMKKVQNH AALEAEVARL RCLLVDIRGR IEGEIGAFPY QRPVKNVDLV  180
SGGVDLLGGG SQVMNSCDFR CNDQLYCNPG MQMRTVGDDG AMNGQAFGQG TGDFVNVQCL  240
GSAKSGSTIS PGCGGMSNMP FGCLPNAKK*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g30140.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563276.10.0basic leucine zipper 23
SwissprotQ8GTS25e-68BZP23_ARATH; Basic leucine zipper 23
TrEMBLI1GVB00.0I1GVB0_BRADI; Uncharacterized protein
STRINGBRADI1G30140.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Representative plantOGRP19701536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.18e-67bZIP family protein
Publications ? help Back to Top
  1. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  2. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  3. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]