PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g26720.1.p
Common NameBRADI_1g26720, LOC100843215
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 193aa    MW: 20049.3 Da    PI: 10.5249
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g26720.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.21.8e-4185161278
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       Cq+e+C adl+eak+yhrrhkvCe+h+ka+vvlv+gl+qrfCqqCsrfhel efD++krsCrrrLa+hnerrrk++a
  Bradi1g26720.1.p  85 CQAERCPADLTEAKRYHRRHKVCEAHAKAAVVLVAGLRQRFCQQCSRFHELLEFDDTKRSCRRRLAGHNERRRKSSA 161
                       **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.7E-3478146IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.94182159IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.28E-3883162IPR004333Transcription factor, SBP-box
PfamPF031104.2E-3185158IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MDRKDKSRKS SSSAASMAAL AAAGGDRMAP PSSGDEDQKP NLVNVPVVAT GASSSSAAAV  60
RRGGGGGAAG GPVAVGGAGA GGPSCQAERC PADLTEAKRY HRRHKVCEAH AKAAVVLVAG  120
LRQRFCQQCS RFHELLEFDD TKRSCRRRLA GHNERRRKSS ADANGGDGCR HVDQDGRSNP  180
GNPPPLNHFQ IR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-3876158184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g26720.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0966261e-113FP096626.1 Phyllostachys edulis cDNA clone: bphylf027p18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560169.31e-136squamosa promoter-binding-like protein 13
SwissprotQ6Z4611e-48SPL13_ORYSJ; Squamosa promoter-binding-like protein 13
TrEMBLI1GU511e-134I1GU51_BRADI; Uncharacterized protein
STRINGBRADI1G26720.11e-135(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85243248
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.23e-41squamosa promoter binding protein-like 4