PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g26570.1.p
Common NameBRADI_1g26570, LOC100841784
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 357aa    MW: 35851.4 Da    PI: 8.0095
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g26570.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.6e-3943102362
            zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +al+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+s+
  Bradi1g26570.1.p  43 AEALRCPRCDSANTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRSR 102
                       57899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.7E-3345100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.38546100IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2548100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MAAGAGGAAA AAAAVQHAGP AGRVGGGGSS SAGGGAAAPD PRAEALRCPR CDSANTKFCY  60
YNNYSLSQPR HFCKACKRYW TRGGTLRNVP VGGGCRKNKR SRSSSGGGGR VVSSSSAAAA  120
AAGGGTASSS LPLPPHGSAS SALQGLHHGS SSLASLLLGT GGGGDHLGLF HQAMQSVVSD  180
NAAAYEMHNQ QQQHQAQVDQ LLGLGYGSHS QIQMNKPWLG HDGAGGLFDG FYAPLLSGCS  240
IVPGLEELHV KAEATAGENH HQHKKDGEQQ QQQSGGSWEQ HPNSSSSNVE ACNNNIMASE  300
ALMAAMNPAA AVSSNAATAP TTVSSSQLMY WGNGGGAPAA WPDIGANCGS SIATFF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g26570.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824038e-78KC582403.1 Sorghum bicolor dof6 protein (dof6) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560166.10.0dof zinc finger protein DOF1.4
TrEMBLI1GU360.0I1GU36_BRADI; Uncharacterized protein
STRINGBRADI1G26570.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88953041
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.24e-31Dof family protein