PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g24390.3.p
Common NameBRADI_1g24390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 261aa    MW: 27334.4 Da    PI: 8.1783
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g24390.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM39.71.5e-1273897128
               NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                       +e+vg+kk Lvfy+g+ pkg kt+W+mheyrl
  Bradi1g24390.3.p   7 REKVGVKKALVFYRGKPPKGLKTNWIMHEYRL 38 
                       578***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100522.207179IPR003441NAC domain
SuperFamilySSF1019415.23E-16879IPR003441NAC domain
PfamPF023652.1E-51038IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MASGCAREKV GVKKALVFYR GKPPKGLKTN WIMHEYRLAD SSSSGATASR PPPVVAGGSG  60
GRAASLRLDD WVLCRIYKKI NKAAAGDQQR SMECEDSVED AVAAYHPSSY AMAGMVGAGA  120
HGGSNNNYTS LLHHHHHHHD SHEDNFLDGL LTVTEDHAGL SAGGTSLQSH LAAASRASLP  180
TAATKQLLAP PSSSATPFNR LHASTAVGIL PQDASTYHQQ HVILGTTSLP VPPESTVSGA  240
ASAFQQQQHP VQISGVNWNP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-18879112165NO APICAL MERISTEM PROTEIN
1ut4_B4e-18879112165NO APICAL MERISTEM PROTEIN
1ut7_A4e-18879112165NO APICAL MERISTEM PROTEIN
1ut7_B4e-18879112165NO APICAL MERISTEM PROTEIN
3swm_A5e-18879115168NAC domain-containing protein 19
3swm_B5e-18879115168NAC domain-containing protein 19
3swm_C5e-18879115168NAC domain-containing protein 19
3swm_D5e-18879115168NAC domain-containing protein 19
3swp_A5e-18879115168NAC domain-containing protein 19
3swp_B5e-18879115168NAC domain-containing protein 19
3swp_C5e-18879115168NAC domain-containing protein 19
3swp_D5e-18879115168NAC domain-containing protein 19
4dul_A4e-18879112165NAC domain-containing protein 19
4dul_B4e-18879112165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM8208883e-98KM820888.1 Triticum aestivum cultivar Chinese Spring NAC transcription factor NAM-B2 (NAM-B2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562891.11e-170PREDICTED: NAC transcription factor NAM-B2-like
SwissprotA0SPJ61e-102NAMB2_TRITD; NAC transcription factor NAM-B2
TrEMBLA0A0Q3NEG40.0A0A0Q3NEG4_BRADI; Uncharacterized protein
STRINGBRADI1G24390.11e-169(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.16e-22NAC domain containing protein 47