PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g24390.1.p
Common NameBRADI_1g24390, LOC100834687
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 436aa    MW: 46589.9 Da    PI: 9.1849
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g24390.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.85.2e-54301581128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+++
  Bradi1g24390.1.p  30 LPPGFRFHPTDEELVVHYLKKKAAKAPLPV-TIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPIM 121
                       79****************************.89***************988899*************************************** PP

               NAM  94 sk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++   +e+vg+kk Lvfy+g+ pkg kt+W+mheyrl
  Bradi1g24390.1.p 122 ASgcAREKVGVKKALVFYRGKPPKGLKTNWIMHEYRL 158
                       *9888899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-6326199IPR003441NAC domain
PROSITE profilePS5100561.36730199IPR003441NAC domain
PfamPF023656.8E-2831158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MRSMGSPDSS SGSAPPQHQQ QQRAGSAPEL PPGFRFHPTD EELVVHYLKK KAAKAPLPVT  60
IIAEVDLYKF DPWELPEKAT FGEQEWYFFS PRDRKYPNGA RPNRAATSGY WKATGTDKPI  120
MASGCAREKV GVKKALVFYR GKPPKGLKTN WIMHEYRLAD SSSSGATASR PPPVVAGGSG  180
GRAASLRLDD WVLCRIYKKI NKAAAGDQQR SMECEDSVED AVAAYHPSSY AMAGMVGAGA  240
HGGSNNNYTS LLHHHHHHHD SHEDNFLDGL LTVTEDHAGL SAGGTSLQSH LAAASRASLP  300
TAATKQLLAP PSSSATPFNR LHASTAVGIL PQARNFPGFN RSRNNNTVGS MSLSSTTTAA  360
AMDDNGRGNN NAVNTMPAFM NALPVVQDAS TYHQQHVILG TTSLPVPPES TVSGAASAFQ  420
QQQHPVQISG VNWNP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-733019917165NO APICAL MERISTEM PROTEIN
1ut4_B3e-733019917165NO APICAL MERISTEM PROTEIN
1ut7_A3e-733019917165NO APICAL MERISTEM PROTEIN
1ut7_B3e-733019917165NO APICAL MERISTEM PROTEIN
3swm_A4e-733019920168NAC domain-containing protein 19
3swm_B4e-733019920168NAC domain-containing protein 19
3swm_C4e-733019920168NAC domain-containing protein 19
3swm_D4e-733019920168NAC domain-containing protein 19
3swp_A4e-733019920168NAC domain-containing protein 19
3swp_B4e-733019920168NAC domain-containing protein 19
3swp_C4e-733019920168NAC domain-containing protein 19
3swp_D4e-733019920168NAC domain-containing protein 19
4dul_A3e-733019917165NAC domain-containing protein 19
4dul_B3e-733019917165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3735150.0AK373515.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3033K10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562891.10.0PREDICTED: NAC transcription factor NAM-B2-like
SwissprotA0SPJ60.0NAMB2_TRITD; NAC transcription factor NAM-B2
SwissprotA0SPJ90.0NAM2_HORVD; NAC transcription factor NAM-2
TrEMBLI1GTC30.0I1GTC3_BRADI; Uncharacterized protein
STRINGBRADI1G24390.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP75723649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.16e-84NAC domain containing protein 25